Transcription Factor
Accessions: | NPAS2 (HT-SELEX2 May2017) |
Names: | ENSG00000170485, NPAS2 |
Organisms: | Homo sapiens |
Libraries: | HT-SELEX2 May2017 1 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
Notes: | TF family: bHLH experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: bHLH experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3 |
Length: | 105 |
Pfam Domains: | 8-55 Helix-loop-helix DNA-binding domain |
Sequence: (in bold interface residues) | 1 EDEKDRAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGFLQKHNEV 60 61 SAQTEICDIQQDWKPSFLSNEEFTQLMLEALDGFIIAVTTDGSII |
Interface Residues: | 3, 7, 8, 9, 11, 12, 13, 14, 15, 16, 18, 19, 20, 43, 48 |
3D-footprint Homologues: | 4zpr_B, 5sy7_B, 1a0a_B, 1an4_A, 4zpk_B, 5eyo_A, 7xhv_B, 4zpk_A, 8osl_O, 7d8t_A, 7xi3_A, 5v0l_A, 7f2f_B, 4h10_A, 7xi3_B, 7ssa_L, 5nj8_D, 4h10_B, 8ia3_B, 6g1l_A, 8osl_P, 5gnj_I, 5nj8_C, 5v0l_B |
Binding Motifs: | NPAS2_2 rmCACGTGyh NPAS2_methyl_1 rmCAyGyGyh |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.