Transcription Factor

Accessions: 4lln_D (3D-footprint 20231221)
Names: MarR family HTH-type transcriptional regulator mepR, MarR family regulatory protein, MarR family transcriptional regulator, MepA/mepB repressor and autoregulator, MepR, Multidrug efflux MATE transporter transcriptional repressor MepR, Multidrug efflux transporter transcriptional repressor MepR, Q5Y812_STAAU, Transcriptional regulator SlyA, Transcriptional regulator, MarR family
Organisms: Staphylococcus aureus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q5Y812
Length: 139
Pfam Domains: 29-88 MarR family
31-88 MarR family
31-96 Winged helix DNA-binding domain
45-78 Winged helix-turn-helix DNA-binding
Sequence:
(in bold interface residues)
1 SNEFTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQNDIAKALQR 60
61 TGPTVSNLLRNLERKKLIYRYVDAQDTRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLS 120
121 EEENEQMKANLTKMLSSLQ
Interface Residues: 52, 61, 62, 63, 64, 66, 67, 70, 71, 88
3D-footprint Homologues: 7el3_B, 5k98_B, 3dnv_B, 6fix_D, 7dvv_A, 1u8r_B, 2isz_B, 1ddn_B, 1f5t_A, 4lln_I, 5hlg_E
Binding Motifs: 4lln_CD TTAGAnnTsTAAnnA
Binding Sites: 4lln_E / 4lln_F
Publications: Birukou I, Seo S.M, Schindler B.D, Kaatz G.W, Brennan R.G. Structural mechanism of transcription regulation of the Staphylococcus aureus multidrug efflux operon mepRA by the MarR family repressor MepR. Nucleic acids research 42:2774-88 (2014). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.