Transcription Factor
Accessions: | 4lln_D (3D-footprint 20241219) |
Names: | MarR family HTH-type transcriptional regulator mepR, MarR family regulatory protein, MarR family transcriptional regulator, MepA/mepB repressor and autoregulator, MepR, Multidrug efflux MATE transporter transcriptional repressor MepR, Multidrug efflux transporter transcriptional repressor MepR, Q5Y812_STAAU, Transcriptional regulator SlyA, Transcriptional regulator, MarR family |
Organisms: | Staphylococcus aureus |
Libraries: | 3D-footprint 20241219 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | Q5Y812 |
Length: | 139 |
Pfam Domains: | 29-88 MarR family 31-88 MarR family 31-96 Winged helix DNA-binding domain 45-78 Winged helix-turn-helix DNA-binding |
Sequence: (in bold interface residues) | 1 SNEFTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQNDIAKALQR 60 61 TGPTVSNLLRNLERKKLIYRYVDAQDTRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLS 120 121 EEENEQMKANLTKMLSSLQ |
Interface Residues: | 52, 61, 62, 63, 64, 66, 67, 70, 71, 88 |
3D-footprint Homologues: | 7el3_B, 1u8r_B, 2isz_B, 7dvv_A |
Binding Motifs: | 4lln_CD TTAGAnnTsTAAnnA |
Binding Sites: | 4lln_E / 4lln_F |
Publications: | Birukou I, Seo S.M, Schindler B.D, Kaatz G.W, Brennan R.G. Structural mechanism of transcription regulation of the Staphylococcus aureus multidrug efflux operon mepRA by the MarR family repressor MepR. Nucleic acids research 42:2774-88 (2014). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.