Transcription Factor

						

			
Accessions: GFI1B (HT-SELEX2 May2017)

			
Names: ENSG00000165702, GFI1B
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 2, TF family: Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 2
Length: 183
Pfam Domains:     16-39 Zinc finger, C2H2 type
    16-39 C2H2-type zinc finger
    31-56 Zinc-finger double domain
    45-67 Zinc finger, C2H2 type
    45-64 C2H2-type zinc finger
    45-67 C2H2-type zinc finger
    45-63 Zinc-finger of C2H2 type
    59-84 Zinc-finger double domain
    73-95 Zinc finger, C2H2 type
    73-91 C2H2-type zinc finger
    73-95 C2H2-type zinc finger
   88-111 Zinc-finger double domain
  101-119 C2H2-type zinc finger
  101-123 Zinc finger, C2H2 type
  101-111 C2H2-type zinc finger
  116-139 Zinc-finger double domain
  128-151 C2H2-type zinc finger
  129-151 C2H2-type zinc finger
  129-151 Zinc finger, C2H2 type
  143-166 Zinc-finger double domain
  157-180 C2H2-type zinc finger
  157-180 Zinc finger, C2H2 type
Sequence: 
(in bold interface residues)		   1 PALDFSLRYSPGMDAYHCVKCNKVFSTPHGLEVHVRRSHSGTRPFACDICGKTFGHAVSL   60
  61 EQHTHVHSQERSFECRMCGKAFKRSSTLSTHLLIHSDTRPYPCQFCGKRFHQKSDMKKHT  120
 121 YIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFSCELCTKGFQRKVDLRRHRESQH  180
 181 NLK
Interface Residues: 27, 29, 30, 33, 53, 55, 56, 57, 58, 59, 62, 63, 66, 73, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 96, 111, 112, 113, 114, 115, 117, 118, 121, 139, 140, 141, 142, 143, 145, 146, 167, 168, 169, 170, 171, 172, 173, 174, 178
3D-footprint Homologues: 6wmi_A, 5und_A, 5k5l_F, 8ssq_A, 1tf6_A, 5v3j_F, 8ssu_A, 8gh6_A, 7y3m_I, 5kkq_D, 6jnm_A, 5k5i_A, 7w1m_H, 4m9v_C, 6e94_A, 7ysf_A, 2i13_A, 6a57_A, 5yel_A, 1ubd_C, 2kmk_A, 7n5w_A, 2drp_D, 2gli_A, 6ml4_A, 5ei9_F, 8gn3_A, 8h9h_G, 7eyi_G, 2lt7_A, 2jpa_A, 1tf3_A, 1mey_C, 7txc_E, 5kl3_A, 1f2i_J, 1g2f_F, 4x9j_A, 6blw_A, 2wbs_A, 6u9q_A, 3uk3_C, 8cuc_F, 7y3l_A, 1llm_D, 5yj3_D
Binding Motifs: GFI1B_2 ymAATCACwGCayykCACTcm
GFI1B_methyl_1 bmAATCAswGCahytCACTcm
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.