Transcription Factor
| Accessions: | T093398_1.02 (CISBP 1.02), POU6F1 (HT-SELEX2 May2017), Q14863 (JASPAR 2024) | 
| Names: | POU6F1, T093398_1.02;, ENSG00000184271, Brain-5, Brain-specific homeobox/POU domain protein 5, Brn-5, mPOU homeobox protein, PO6F1_HUMAN, POU domain, class 6, transcription factor 1 | 
| Organisms: | Homo sapiens | 
| Libraries: | CISBP 1.02 1, HT-SELEX2 May2017 2, JASPAR 2024 3 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] 3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]  | 
| Notes: | experiment type:PBM, family:Homeodomain, TF family: POU experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: POU experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4 | 
| Length: | 301 | 
| Pfam Domains: |   140-213 Pou domain - N-terminal to homeobox domain 235-290 Homeobox domain  | 
| Sequence:  (in bold interface residues)  |    1 MPGISSQILTNAQGQVIGTLPWVVNSASVAAPAPAQSLQVQAVTPQLLLNAQGQVIATLA   60 61 SSPLPPPVAVRKPSTPESPAKSEVQPIQPTPTVPQPAVVIASPAPAAKPSASAPIPITCS 120 121 ETPTVSQLVSKPHTPSLDEDGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAY 180 181 SQSAICRFEKLDITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFVGGEPSKKRKRRTS 240 241 FTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQI 300 301 P  | 
| Interface Residues: | 165, 166, 181, 182, 183, 184, 186, 187, 193, 197, 234, 235, 236, 237, 238, 239, 240, 276, 277, 279, 280, 283, 284, 286, 287, 288 | 
| 3D-footprint Homologues: | 8bx1_A, 7u0g_M, 3d1n_M, 4cja_A, 1e3o_C, 1au7_A, 1o4x_A, 2xsd_C, 7xrc_C, 8g87_X, 4j19_B, 5zfz_A, 3cmy_A, 8ejp_B, 1fjl_B, 6a8r_A, 1puf_A, 8pmf_A, 1ig7_A, 1jgg_B, 2lkx_A, 1nk2_P, 1zq3_P, 3lnq_A, 7q3o_C, 2ld5_A, 1mnm_C, 6es3_K, 3a01_E, 1puf_B, 9b8u_A, 8ik5_C, 4xrs_G, 4cyc_A, 2r5y_A, 8osb_E, 5hod_A, 2hdd_A, 8eml_B, 1b72_A, 5jlw_D, 1k61_B, 1le8_A, 4qtr_D, 5zjt_E, 1du0_A | 
| Binding Motifs: | M0899_1.02 ayTAATTArt M3780_1.02 ATAAwTTATGC MA0628.1 ayTAATTArt MA1549.1 / POU6F1_5 rTAATGAGst POU6F1_6 rtAATgakaTgyrc POU6F1_7 TATGCwwvGCATa POU6F1_8 cATTATgckvhgcATAATg POU6F1_methyl_1 rTAATGAkATGCrk POU6F1_methyl_2 wTATGyTAATGAgs POU6F1_methyl_3 wTAATGAGaw POU6F1_methyl_4 TmATTacmscTCATtA MA0628.2 TAATTA MA1549.2 TAATGAG  | 
| Publications: | Rhee J. M., Gruber C. A., Brodie T. B., Trieu M., Turner E. E. Highly cooperative homodimerization is a conserved property of neural POU proteins. J. Biol. Chem. 273:34196-34205 (1998). [Pubmed] Mistri TK, Devasia AG, Chu LT, Ng WP, Halbritter F, Colby D, Martynoga B, Tomlinson SR, Chambers I, Robson P, Wohland T. Selective influence of Sox2 on POU transcription factor binding in embryonic and neural stem cells. EMBO Rep 16:1177-91 (2015). [Pubmed]  | 
| Related annotations: | PaperBLAST | 
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.