Transcription Factor

Accessions: T093398_1.02 (CISBP 1.02), POU6F1 (HT-SELEX2 May2017), Q14863 (JASPAR 2024)
Names: POU6F1, T093398_1.02;, ENSG00000184271, Brain-5, Brain-specific homeobox/POU domain protein 5, Brn-5, mPOU homeobox protein, PO6F1_HUMAN, POU domain, class 6, transcription factor 1
Organisms: Homo sapiens
Libraries: CISBP 1.02 1, HT-SELEX2 May2017 2, JASPAR 2024 3
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Notes: experiment type:PBM, family:Homeodomain, TF family: POU experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: POU experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4
Length: 301
Pfam Domains: 140-213 Pou domain - N-terminal to homeobox domain
235-290 Homeobox domain
Sequence:
(in bold interface residues)
1 MPGISSQILTNAQGQVIGTLPWVVNSASVAAPAPAQSLQVQAVTPQLLLNAQGQVIATLA 60
61 SSPLPPPVAVRKPSTPESPAKSEVQPIQPTPTVPQPAVVIASPAPAAKPSASAPIPITCS 120
121 ETPTVSQLVSKPHTPSLDEDGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAY 180
181 SQSAICRFEKLDITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFVGGEPSKKRKRRTS 240
241 FTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQI 300
301 P
Interface Residues: 165, 166, 181, 182, 183, 184, 186, 187, 193, 197, 234, 235, 236, 237, 238, 239, 240, 276, 277, 279, 280, 283, 284, 286, 287, 288
3D-footprint Homologues: 8bx1_A, 7u0g_M, 3d1n_M, 4cja_A, 1e3o_C, 1au7_A, 1o4x_A, 2xsd_C, 7xrc_C, 8g87_X, 4j19_B, 5zfz_A, 3cmy_A, 8ejp_B, 1fjl_B, 6a8r_A, 1puf_A, 8pmf_A, 1ig7_A, 1jgg_B, 2lkx_A, 1nk2_P, 1zq3_P, 3lnq_A, 7q3o_C, 2ld5_A, 1mnm_C, 6es3_K, 3a01_E, 1puf_B, 9b8u_A, 8ik5_C, 4xrs_G, 4cyc_A, 2r5y_A, 8osb_E, 5hod_A, 2hdd_A, 8eml_B, 1b72_A, 5jlw_D, 1k61_B, 1le8_A, 4qtr_D, 5zjt_E, 1du0_A
Binding Motifs: M0899_1.02 ayTAATTArt
M3780_1.02 ATAAwTTATGC
MA0628.1 ayTAATTArt
MA1549.1 / POU6F1_5 rTAATGAGst
POU6F1_6 rtAATgakaTgyrc
POU6F1_7 TATGCwwvGCATa
POU6F1_8 cATTATgckvhgcATAATg
POU6F1_methyl_1 rTAATGAkATGCrk
POU6F1_methyl_2 wTATGyTAATGAgs
POU6F1_methyl_3 wTAATGAGaw
POU6F1_methyl_4 TmATTacmscTCATtA
MA0628.2 TAATTA
MA1549.2 TAATGAG
Publications: Rhee J. M., Gruber C. A., Brodie T. B., Trieu M., Turner E. E. Highly cooperative homodimerization is a conserved property of neural POU proteins. J. Biol. Chem. 273:34196-34205 (1998). [Pubmed]

Mistri TK, Devasia AG, Chu LT, Ng WP, Halbritter F, Colby D, Martynoga B, Tomlinson SR, Chambers I, Robson P, Wohland T. Selective influence of Sox2 on POU transcription factor binding in embryonic and neural stem cells. EMBO Rep 16:1177-91 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.