Transcription Factor

Accessions: ALX3_DBD (HumanTF 1.0), ALX3 (HT-SELEX2 May2017)
Names: ALX3, ALX3_HUMAN, Homeobox protein aristaless-like 3, Proline-rich transcription factor ALX3, ENSG00000156150
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HT-SELEX2 May2017 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: O95076
Notes: Ensembl ID: ENSG00000156150; DNA-binding domain sequence; TF family: homeodomain; Clone source: Gene synthesis, TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3
Length: 134
Pfam Domains: 48-104 Homeobox domain
Sequence:
(in bold interface residues)
1 PLDCRGGPRDGPSNLQGSPGPCLASLHLPLSPGLPDSMELAKNKSKKRRNRTTFSTFQLE 60
61 ELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRKRERYGKIQEGRNPFTA 120
121 AYDISVLPRTDSHP
Interface Residues: 47, 48, 49, 50, 51, 89, 90, 92, 93, 96, 97, 100, 101, 104
3D-footprint Homologues: 4j19_B, 1ig7_A, 5zfz_A, 2h1k_B, 1puf_A, 3cmy_A, 1fjl_B, 6a8r_A, 3d1n_M, 1jgg_B, 6m3d_C, 3lnq_A, 2lkx_A, 1nk2_P, 1zq3_P, 2ld5_A, 6es3_K, 4xrs_G, 3l1p_A, 3a01_E, 5flv_I, 5zjt_E, 2hdd_A, 7psx_B, 1au7_A, 5hod_A, 3rkq_B, 2r5y_A, 1puf_B, 2hos_A, 7q3o_C, 1b72_A, 5jlw_D, 4cyc_A, 7xrc_C, 1e3o_C, 1le8_A, 2xsd_C, 1o4x_A, 1du0_A, 8g87_X, 4qtr_D, 4xrm_B
Binding Motifs: ALX3_DBD rcyAATTArc
ALX3_3 cyAATTAa
ALX3_6 cyAATTAv
ALX3_methyl_1 cyAATTAm
ALX3_methyl_2 ckcrTTAr
ALX3_methyl_4 cyAATTAm
ALX3_methyl_5 mwCrTTAr
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.