Transcription Factor
| Accessions: | 1j1v_A (3D-footprint 20260701) |
| Names: | Chromosomal replication initiator protein dnaA, DNAA_ECOLI |
| Organisms: | Escherichia coli, strain K12 |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P03004 |
| Length: | 94 |
| Pfam Domains: | 2-71 Bacterial dnaA protein helix-turn-helix |
| Sequence: (in bold interface residues) | 1 VTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRD 60 61 HTTVLHACRKIEQLREESHDIKEDFSNLIRTLSS |
| Interface Residues: | 60, 61, 62, 63, 66 |
| 3D-footprint Homologues: | 8btg_B |
| Binding Motifs: | 1j1v_A ATCCACA |
| Binding Sites: | 1j1v_B 1j1v_C |
| Publications: | Fujikawa N, Kurumizaka H, Nureki O, Terada T, Shirouzu M, Katayama T, Yokoyama S. Structural basis of replication origin recognition by the DnaA protein. Nucleic acids research 31:2077-86 (2003). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.