Transcription Factor

Accessions: 1j1v_A (3D-footprint 20231221)
Names: Chromosomal replication initiator protein dnaA, DNAA_ECOLI
Organisms: Escherichia coli, strain K12
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P03004
Length: 94
Pfam Domains: 2-71 Bacterial dnaA protein helix-turn-helix
Sequence:
(in bold interface residues)
1 VTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRD 60
61 HTTVLHACRKIEQLREESHDIKEDFSNLIRTLSS
Interface Residues: 26, 50, 60, 61, 62, 65, 66
3D-footprint Homologues: 3pvv_B
Binding Motifs: 1j1v_A ATCCACA
Binding Sites: 1j1v_B
1j1v_C
Publications: Fujikawa N, Kurumizaka H, Nureki O, Terada T, Shirouzu M, Katayama T, Yokoyama S. Structural basis of replication origin recognition by the DnaA protein. Nucleic acids research 31:2077-86 (2003). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.