Transcription Factor
| Accessions: | T095204_1.02 (CISBP 1.02), P42581 (JASPAR 2024) |
| Names: | Hmx3, T095204_1.02;, HMX3_MOUSE, Homeobox protein H6 family member 3, Homeobox protein HMX3, Homeobox protein Nkx-5.1 |
| Organisms: | Mus musculus |
| Libraries: | CISBP 1.02 1, JASPAR 2024 2 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | P42581 |
| Notes: | family:Homeodomain |
| Length: | 356 |
| Pfam Domains: | 228-284 Homeobox domain |
| Sequence: (in bold interface residues) | 1 MPEPGPDASGTASAPPPQPPPQPPAPKESPFSIRNLLNGDHHRPPPKPQPPPRTLFAPAS 60 61 AAAAAAAAAAAAAKGALEGAAGFALSQVGDLAFPRFEIPAQRFALPAHYLERSPAWWYPY 120 121 TLTPAGGHLPRPEASEKALLRDSSPASGTDRDSPEPLLKADPDHKELDSKSPDEIILEES 180 181 DSEEGKKEGEAVPGAAGTTVGATTATPGSEDWKAGAESPEKKPACRKKKTRTVFSRSQVF 240 241 QLESTFDMKRYLSSSERAGLAASLHLTETQVKIWFQNRRNKWKRQLAAELEAANLSHAAA 300 301 QRIVRVPILYHENSAAEGAAAAAGAPVPVSQPLLTFPHPVYYSHPVVSSVPLLRPV |
| Interface Residues: | 228, 229, 230, 231, 269, 270, 272, 273, 276, 277, 279, 280, 281, 284 |
| 3D-footprint Homologues: | 5zfz_A, 1fjl_B, 3cmy_A, 1puf_A, 1ig7_A, 3d1n_M, 8pmf_A, 6a8r_A, 8ejp_B, 2lkx_A, 6m3d_C, 1jgg_B, 3lnq_A, 1nk2_P, 1zq3_P, 7q3o_C, 2ld5_A, 6es3_K, 7psx_B, 3rkq_B, 8eml_B, 5flv_I, 2hdd_A, 5zjt_E, 1b72_A, 4cyc_A, 2r5y_A, 2hos_A, 8ik5_C, 5jlw_D, 9b8u_A, 4xrs_G, 3a01_E, 8osb_E, 1au7_A, 8pi8_B, 1le8_A, 7xrc_C, 2xsd_C, 1e3o_C, 1k61_B, 1o4x_A, 6fqp_B, 8g87_X, 6fqq_E, 5hod_A, 1mnm_C, 1du0_A, 4qtr_D, 1puf_B |
| Binding Motifs: | M3401_1.02 CAAGTGCGTG MA0898.1 / PH0043.1 asaAgCAATTAAwrrat MA0898.2 AgCAATTAA |
| Publications: | Berger M.F, Badis G, Gehrke A.R, Talukder S, Philippakis A.A, Peña-Castillo L, Alleyne T.M, Mnaimneh S, Botvinnik O.B, Chan E.T, Khalid F, Zhang W, Newburger D, Jaeger S.A, Morris Q.D, Bulyk M.L, Hughes T.R. Variation in homeodomain DNA binding revealed by high-resolution analysis of sequence preferences. Cell 133:1266-76 (2008). [Pubmed] Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.