Transcription Factor

Accessions: 4umm_E (3D-footprint 20250804)
Names: 20-hydroxy-ecdysone receptor, 20E receptor, ECDYSONE RECEPTOR, Ecdysteroid receptor, ECR_HELVI, EcRH, HvEcR, Nuclear receptor subfamily 1 group H member 1
Organisms: Heliothis virescens, Tobacco budworm moth
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: O18473
Length: 87
Pfam Domains: 6-73 Zinc finger, C4 type (two domains)
Sequence:
(in bold interface residues)
1 RQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKNAVYICKFGHACEMDMYMRRKCQ 60
61 ECRLKKCLAVGMRPECVVPENQCAMKR
Interface Residues: 15, 16, 18, 19, 25, 26, 28, 29, 32, 33, 57, 86
3D-footprint Homologues: 6fbq_A, 6l6q_B, 7wnh_D, 1lo1_A, 3g9m_B, 1a6y_A, 4oln_B, 1dsz_A, 4umm_E, 3cbb_A, 7xvn_C, 4iqr_B, 2han_A, 1hcq_E, 8cef_H, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 8hbm_B, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 8rm6_A, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A, 5cbz_E, 4tnt_B, 5e69_A, 4hn5_B
Binding Motifs: 4umm_AE GTtCAntnnAC
Binding Sites: 4umm_C
4umm_D
Publications: Maletta M, Orlov I, Roblin P, Beck Y, Moras D, Billas I.M, Klaholz B.P. The palindromic DNA-bound USP/EcR nuclear receptor adopts an asymmetric organization with allosteric domain positioning. Nature communications 5:4139 (2014). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.