Transcription Factor

						

			
Accessions: 4umm_E (3D-footprint 20231221)

			
Names: 20-hydroxy-ecdysone receptor, 20E receptor, ECDYSONE RECEPTOR, Ecdysteroid receptor, ECR_HELVI, EcRH, HvEcR, Nuclear receptor subfamily 1 group H member 1
Organisms: Heliothis virescens, Tobacco budworm moth
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: O18473
Length: 87
Pfam Domains:      6-73 Zinc finger, C4 type (two domains)
Sequence: 
(in bold interface residues)		   1 RQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKNAVYICKFGHACEMDMYMRRKCQ   60
  61 ECRLKKCLAVGMRPECVVPENQCAMKR
Interface Residues: 15, 16, 18, 19, 25, 26, 28, 29, 32, 33, 57, 86
3D-footprint Homologues: 6fbq_A, 6l6q_B, 7wnh_D, 1lo1_A, 3g9m_B, 1a6y_A, 4oln_B, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 8cef_H, 4iqr_B, 2han_A, 1hcq_E, 8hbm_B, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 4tnt_B, 5e69_A, 4hn5_B, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A, 5cbz_E
Binding Motifs: 4umm_AE GTtCAntnnAC
Binding Sites: 4umm_C
4umm_D
			
Publications: Maletta M, Orlov I, Roblin P, Beck Y, Moras D, Billas I.M, Klaholz B.P. The palindromic DNA-bound USP/EcR nuclear receptor adopts an asymmetric organization with allosteric domain positioning. Nature communications 5:4139 (2014). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.