Transcription Factor
| Accessions: | GATA4 (Athamap 20091028), T084299_1.02 (CISBP 1.02), T15644 (AthalianaCistrome v4_May2016), O49743 (JASPAR 2024) | 
| Names: | AtGATA-4, GATA transcription factor 4, GATA4, T084299_1.02;, AT3G60530, T15644;, GATA4_ARATH | 
| Organisms: | Arabidopsis thaliana | 
| Libraries: | Athamap 20091028 1, CISBP 1.02 2, AthalianaCistrome v4_May2016 3, JASPAR 2024 4 1 Bulow L, Engelmann S, Schindler M, Hehl R. AthaMap, integrating transcriptional and post-transcriptional data. Nucleic acids research 37:D983-6 (2009). [Pubmed] 2 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 3 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] 4 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]  | 
| Uniprot: | O49743 | 
| Notes: | experiment type:PBM, family:GATA, ecotype:Col-0, experiment type: DAP-seq, family:C2C2-GATA | 
| Length: | 240 | 
| Pfam Domains: | 160-194 GATA zinc finger | 
| Sequence:  (in bold interface residues)  |    1 MDVYGMSSPDLLRIDDLLDFSNDEIFSSSSTVTSSAASSAASSENPFSFPSSTYTSPTLL   60 61 TDFTHDLCVPSDDAAHLEWLSRFVDDSFSDFPANPLTMTVRPEISFTGKPRSRRSRAPAP 120 121 SVAGTWAPMSESELCHSVAKPKPKKVYNAESVTADGARRCTHCASEKTPQWRTGPLGPKT 180 181 LCNACGVRYKSGRLVPEYRPASSPTFVLTQHSNSHRKVMELRRQKEQQESCVRIPPFQPQ 240  | 
| Interface Residues: | 169, 170, 172, 183, 187, 188, 191, 211 | 
| 3D-footprint Homologues: | 1gat_A, 4hc9_A, 3dfx_B, 3vd6_C, 4gat_A | 
| Binding Motifs: | GATA4 ATgAwwmsrC M0766_1.02 hyrGATCyrd M0287 wyyyrGATCyrrwyy MA1755.1 hyrGATCyrd MA1755.2 GATC  | 
| Binding Sites: | GATA4_1 GATA4_2 GATA4_3 GATA4_4 GATA4_5  | 
| Publications: | Teakle GR, Manfield IW, Graham JF, Gilmartin PM. 2002. Arabidopsis thaliana GATA factors: organisation, expression and DNA-binding characteristics. Plant Mol Biol. 50:43-57. [Pubmed] O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]  | 
| Related annotations: | PaperBLAST | 
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.