Transcription Factor

Accessions: C8VAA8 (JASPAR 2024)
Names: C8VAA8_EMENI, Eurofung, Putative Zn(II)2Cys6 transcription factor
Organisms: Emericella nidulans
Libraries: JASPAR 2024 1
1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Uniprot: C8VAA8
Length: 181
Pfam Domains: 9-44 Fungal Zn(2)-Cys(6) binuclear cluster domain
Sequence:
(in bold interface residues)
1 MTDKQNPIACEPCRQKKCKCDRILPACSQCSDPAKCVYPESGKRGLPQGYITHLESRLAA 60
61 TERALYSSYSYLRTSSPRSFSIPNSSQPGPSRTAAVNEWSRLPLRNADDLELWWAEKTPL 120
121 YGTAARDAFSEWGLPTRDKGIPAPTSPVNLNSRHVDAGPSTGHPREGRAELLAESEPSVY 180
181 F
Interface Residues: 9, 16, 17, 18, 44
3D-footprint Homologues: 2hap_D, 2er8_C, 1pyi_A, 6gys_C, 7uik_T, 1d66_B, 3coq_A
Binding Motifs: UN0299.1 gTCCGGAk
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.