Transcription Factor
Accessions: | 6lc1_D (3D-footprint 20231221), 6lc1_J (3D-footprint 20231221) |
Names: | Early response protein NAK1, NR4A1_HUMAN, Nuclear hormone receptor NUR/77, Nuclear receptor subfamily 4 group A member 1, Nur77, Orphan nuclear receptor HMR, Orphan nuclear receptor TR3, ST-59, Testicular receptor 3 |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P22736 |
Length: | 86 |
Pfam Domains: | 2-70 Zinc finger, C4 type (two domains) |
Sequence: (in bold interface residues) | 1 GRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRF 60 61 QKCLAVGMVKEVVRTDSLKGRRGRLP |
Interface Residues: | 11, 12, 14, 15, 21, 22, 24, 25, 28, 29, 33, 34, 37, 53, 79, 82, 84 |
3D-footprint Homologues: | 6fbq_A, 6l6q_B, 7wnh_D, 3g9m_B, 1a6y_A, 1lo1_A, 4oln_B, 4iqr_B, 2han_A, 1hcq_E, 4umm_E, 8cef_H, 2han_B, 1kb2_B, 2a66_A, 8hbm_B, 5krb_G, 2nll_B, 1lat_A, 2ff0_A, 1dsz_A, 3cbb_A, 7xv6_B, 5e69_A, 3g6t_A, 1r4i_A, 5emc_A, 7prw_B, 5cbx_B, 5cbz_E, 4hn5_B, 4tnt_B, 4rul_A |
Binding Motifs: | 6lc1_AD TGnCATnTGnnnGTnnATAnCA 6lc1_GJ TGnCATnTgnnnGTAnATAnnA |
Binding Sites: | 6lc1_C 6lc1_F 6lc1_I 6lc1_L |
Publications: | Jiang L, Wei H, Yan N, Dai S, Li J, Qu L, Chen X, Guo M, Chen Z, Chen Y. Structural basis of NR4A1 bound to the human pituitary proopiomelanocortin gene promoter. Biochem Biophys Res Commun 523:1-5 (2020). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.