Transcription Factor

Accessions: 6lc1_D (3D-footprint 20241219), 6lc1_J (3D-footprint 20241219)
Names: Early response protein NAK1, NR4A1_HUMAN, Nuclear hormone receptor NUR/77, Nuclear receptor subfamily 4 group A member 1, Nur77, Orphan nuclear receptor HMR, Orphan nuclear receptor TR3, ST-59, Testicular receptor 3
Organisms: Homo sapiens
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P22736
Length: 86
Pfam Domains: 2-70 Zinc finger, C4 type (two domains)
Sequence:
(in bold interface residues)
1 GRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRF 60
61 QKCLAVGMVKEVVRTDSLKGRRGRLP
Interface Residues: 12, 14, 21, 24, 25, 28, 29, 53, 79, 82, 84
3D-footprint Homologues: 7wnh_D, 6l6q_B, 3g9m_B, 2nll_B, 8hbm_B, 2ff0_A, 7xv6_B, 2han_A, 7xvn_C, 2han_B, 8cef_H, 2a66_A, 5cbz_E, 3g6t_A, 8rm6_A, 7prw_B, 5cbx_B
Binding Motifs: 6lc1_AD TGnCATnTGnnnGTnnATAnCA
6lc1_GJ TGnCATnTgnnnGTAnATAnnA
Binding Sites: 6lc1_C
6lc1_F
6lc1_I
6lc1_L
Publications: Jiang L, Wei H, Yan N, Dai S, Li J, Qu L, Chen X, Guo M, Chen Z, Chen Y. Structural basis of NR4A1 bound to the human pituitary proopiomelanocortin gene promoter. Biochem Biophys Res Commun 523:1-5 (2020). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.