Transcription Factor

						

			
Accessions: ZNF501 (HT-SELEX2 May2017)

			
Names: ENSG00000186446, ZNF501
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 4b0, TF family: Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 4b0
Length: 271
Pfam Domains:     23-44 Zinc finger, C2H2 type
    23-44 C2H2-type zinc finger
    23-45 C2H2-type zinc finger
    36-59 Zinc-finger double domain
    50-72 Zinc finger, C2H2 type
    50-72 C2H2-type zinc finger
    50-70 C2H2-type zinc finger
    64-87 Zinc-finger double domain
    77-98 C2H2-type zinc finger
   78-100 Zinc finger, C2H2 type
   78-100 C2H2-type zinc finger
   93-115 Zinc-finger double domain
  105-126 C2H2-type zinc finger
  106-128 Zinc finger, C2H2 type
  106-128 C2H2-type zinc finger
  121-144 Zinc-finger double domain
  133-156 C2H2-type zinc finger
  134-156 Zinc finger, C2H2 type
  134-156 C2H2-type zinc finger
  149-172 Zinc-finger double domain
  162-182 C2H2-type zinc finger
  162-184 Zinc finger, C2H2 type
  162-184 C2H2-type zinc finger
  177-201 Zinc-finger double domain
  189-212 C2H2-type zinc finger
  190-212 C2H2-type zinc finger
  190-212 Zinc finger, C2H2 type
  204-228 Zinc-finger double domain
  217-236 C2H2-type zinc finger
  218-240 Zinc finger, C2H2 type
  218-240 C2H2-type zinc finger
  232-257 Zinc-finger double domain
  246-268 Zinc finger, C2H2 type
  246-268 C2H2-type zinc finger
  246-268 C2H2-type zinc finger
Sequence: 
(in bold interface residues)		   1 MNSSQISLRMKHGRVNMQKKPSKCSECGKFFTQRSSLTQHQRIHRGEKPYVCSECGSCFR   60
  61 KQSNLTQHLRIHTGEKPYKCNECEKAFQTKAILVQHLRIHTGEKPYKCNECGKAFCQSPS  120
 121 LIKHQRIHTGEKPYKCTECGKAFSQSICLTRHQRSHSGDKPFKCNECGKAFNQSACLMQH  180
 181 QRIHSGEKPYTCTECGKAFTQNSSLVEHERTHTGEKLYKCSECEKTFRKQAHLSEHYRIH  240
 241 TGEKPYECVGCGKSFRHSSALLRHQRLHAGE
Interface Residues: 33, 34, 35, 36, 39, 40, 43, 47, 50, 60, 61, 62, 63, 64, 65, 67, 68, 71, 88, 89, 90, 91, 92, 94, 95, 99, 116, 117, 118, 119, 120, 122, 123, 125, 126, 127, 129, 144, 145, 147, 148, 149, 150, 151, 172, 173, 174, 175, 176, 179, 200, 201, 202, 203, 204, 206, 207, 213, 227, 229, 231, 232, 235, 239, 256, 257, 258, 259, 260, 262, 263
3D-footprint Homologues: 8ssq_A, 7w1m_H, 8ssu_A, 4m9v_C, 7y3m_I, 5yel_A, 1yuj_A, 2kmk_A, 1tf3_A, 3uk3_C, 5v3j_F, 5k5l_F, 1tf6_A, 6u9q_A, 4x9j_A, 1g2f_F, 7n5w_A, 6ml4_A, 8gn3_A, 8h9h_G, 1ubd_C, 1f2i_J, 6blw_A, 2gli_A, 5kkq_D, 5ei9_F, 7txc_E, 7ysf_A, 6e94_A, 2jpa_A, 8cuc_F, 2wbs_A, 1llm_D, 5kl3_A, 7y3l_A, 5k5i_A, 6jnm_A, 2drp_D, 2lt7_A, 6a57_A, 5yj3_D
Binding Motifs: ZNF501_2 cggCgACGCGAACac
ZNF501_methyl_1 csgcsACgCGAmCac
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.