Transcription Factor

Accessions: 6wc5_N (3D-footprint 20231221)
Names: Cardiac-specific homeobox, Homeobox protein CSX, Homeobox protein NK-2 homolog E, Homeobox protein Nkx-2.5, NKX25_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P52952
Length: 55
Pfam Domains: 1-55 Homeobox domain
Sequence:
(in bold interface residues)
1 KPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKSK
Interface Residues: 1, 2, 3, 41, 42, 44, 45, 48, 49, 52, 53
3D-footprint Homologues: 1nk2_P, 1zq3_P, 6m3d_C, 2lkx_A, 7q3o_C, 6es3_K, 2ld5_A, 2hdd_A, 7psx_B, 5hod_A, 3rkq_B, 2r5y_A, 6a8r_A, 1au7_A, 3d1n_M, 2hos_A, 1fjl_B, 5jlw_D, 4cyc_A, 2h1k_B, 1b72_A, 4xrs_G, 1puf_A, 1ig7_A, 5zfz_A, 3a01_E, 5flv_I, 3lnq_A, 1jgg_B, 5zjt_E, 3cmy_A, 1e3o_C, 2xsd_C, 1le8_A, 7xrc_C, 4j19_B, 2h8r_B, 1k61_B, 4xrm_B, 1o4x_A, 3l1p_A, 1mnm_C, 1du0_A, 1puf_B, 8g87_X, 4qtr_D
Binding Motifs: 6wc5_CDN CTTTCynnnnnTAG
6wc5_N CnCTTT
Binding Sites: 6wc5_G
6wc5_H
Publications: Lei X, Zhao J, Sagendorf JM, Rajashekar N, Xu J, Dantas Machado AC, Sen C, Rohs R, Feng P, Chen L. Crystal Structures of Ternary Complexes of MEF2 and NKX2-5 Bound to DNA Reveal a Disease Related Protein-Protein Interaction Interface. J Mol Biol 432:5499-5508 (2020). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.