Transcription Factor
| Accessions: | T025927_1.02 (CISBP 1.02), ATF3_MOUSE (HOCOMOCO 10), Q60765 (JASPAR 2024) |
| Names: | Atf3, T025927_1.02;, Activating transcription factor 3, ATF3_MOUSE, cAMP-dependent transcription factor ATF-3, Cyclic AMP-dependent transcription factor ATF-3, Transcription factor LRG-21 |
| Organisms: | Mus musculus |
| Libraries: | CISBP 1.02 1, HOCOMOCO 10 2, JASPAR 2024 3 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | experiment type:PBM, family:bZIP |
| Length: | 181 |
| Pfam Domains: | 84-141 bZIP transcription factor 85-138 Basic region leucine zipper |
| Sequence: (in bold interface residues) | 1 MMLQHPGQVSASEVSATAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSS 60 61 ALESVTVNNRPLEMSVTKSEAAPEEDERKRRRRERNKIAAAKCRNKKKEKTECLQKESEK 120 121 LESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQ 180 181 S |
| Interface Residues: | 92, 93, 96, 97, 99, 100, 103, 104, 107 |
| 3D-footprint Homologues: | 7x5e_F, 1skn_P, 2wt7_A, 7x5e_E, 8k8c_A, 6mg1_B, 5vpe_C, 5vpe_D, 5t01_B |
| Binding Motifs: | M0298_1.02 tgaTgAcgy MA0605.1 GATGACGt ATF3_MOUSE.H10MO.A|M01016 gTGAykyma MA1988.1 drTGACTCAth MA1988.2 TGACTCA |
| Binding Sites: | MA1988.2.13 / MA1988.2.7 MA1988.2.10 / MA1988.2.12 / MA1988.2.14 / MA1988.2.15 / MA1988.2.17 / MA1988.2.20 / MA1988.2.5 / MA1988.2.6 / MA1988.2.8 MA1988.2.3 / MA1988.2.9 MA1988.2.11 / MA1988.2.16 / MA1988.2.19 / MA1988.2.4 MA1988.2.18 MA1988.1.16 MA1988.1.17 MA1988.1.1 MA1988.1.10 / MA1988.1.14 MA1988.1.11 / MA1988.1.15 MA1988.1.12 / MA1988.1.16 MA1988.1.13 / MA1988.1.17 MA1988.1.14 / MA1988.1.19 MA1988.1.15 MA1988.1.18 MA1988.1.19 MA1988.1.2 MA1988.1.20 MA1988.1.2 / MA1988.1.3 MA1988.1.4 MA1988.1.5 MA1988.1.6 / MA1988.1.7 MA1988.1.7 / MA1988.1.8 MA1988.1.11 / MA1988.1.8 MA1988.1.12 / MA1988.1.9 MA1988.2.1 MA1988.1.10 MA1988.1.13 MA1988.1.18 MA1988.1.20 MA1988.1.3 MA1988.1.6 MA1988.1.9 MA1988.2.2 |
| Publications: | Rehfuss R. P., Walton K. M., Loriaux M. M., Goodman R. H. The cAMP-regulated enhancer-binding protein ATF-1 activates transcription in response to cAMP-dependent protein kinase A. J. Biol. Chem. 266:18431-18434 (1991). [Pubmed] Zhao J, Li X, Guo M, Yu J, Yan C. The common stress responsive transcription factor ATF3 binds genomic sites enriched with p300 and H3K27ac for transcriptional regulation. BMC Genomics : (2016). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.