Transcription Factor
Accessions: | CG10267 (FlyZincFinger 1.0 ) |
Names: | CG10267 |
Organisms: | Drosophila melanogaster |
Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
Notes: | family:Cys2His2 zinc finger |
Length: | 151 |
Pfam Domains: | 34-56 Zinc-finger of C2H2 type 34-56 C2H2-type zinc finger 34-56 Zinc finger, C2H2 type 49-71 Zinc-finger double domain 62-84 C2H2-type zinc finger 77-101 Zinc-finger double domain 90-112 Zinc finger, C2H2 type 90-112 C2H2-type zinc finger 104-127 Zinc-finger double domain 118-139 C2H2-type zinc finger |
Sequence: (in bold interface residues) | 1 TEKGGYICDVCGNFYEKRGRMMEHRRRHDGICQYACELCDAKFQVREQLRKHMYSHTGSK 60 61 PYKCSFCSRQFFYESVLKSHENVHRGIKPYVCKVCDKAFAYAHSLTKHELIHSDIKLYRC 120 121 DYCNKDFRLLHHMRQHEETKLHQNAVMLAES |
Interface Residues: | 17, 18, 19, 20, 22, 23, 25, 26, 27, 29, 34, 44, 45, 46, 47, 48, 51, 72, 73, 74, 75, 76, 77, 78, 79, 80, 83, 100, 101, 102, 103, 104, 105, 106, 107, 108, 111, 125, 127, 128, 129, 130, 131, 132, 134, 135 |
3D-footprint Homologues: | 5ei9_F, 8ssq_A, 5und_A, 8ssu_A, 1tf6_A, 5v3j_F, 5kkq_D, 6u9q_A, 2i13_A, 2jpa_A, 1ubd_C, 2itl_B, 2kmk_A, 3uk3_C, 7y3l_A, 7n5w_A, 7w1m_H, 2gli_A, 1g2f_F, 5k5i_A, 6ml4_A, 6blw_A, 5yel_A, 4x9j_A, 5kl3_A, 1f2i_J, 7eyi_G, 8h9h_G, 7y3m_I, 6e94_A, 7ysf_A, 6wmi_A, 1tf3_A, 6jnm_A, 8cuc_F, 5yj3_D, 8gn3_A, 1llm_D, 1mey_C, 2wbs_A, 4m9v_C, 2lt7_A, 6a57_A, 7txc_E, 2drp_D |
Binding Motifs: | CG10267_SANGER_5_FBgn0037446 whyAACACTR CG10267_SOLEXA_5_FBgn0037446 cakcwwayAACACTAsmmwt |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.