Transcription Factor

Accessions: fru (FlyZincFinger 1.0 )
Names: CG14307
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 84
Pfam Domains: 36-59 Zinc-finger double domain
48-68 C2H2-type zinc finger
48-71 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 NRRDHNIDYSTLFVQLSGTLPTLYRCVSCNKIVSNRWHHANIHRPQSHECPVCGQKFTRR 60
61 DNMKAHCKIKHADIKDRFFSHYVH
Interface Residues: 10, 11, 33, 34, 35, 36, 37, 38, 41, 46, 58, 59, 60, 61, 62, 65
3D-footprint Homologues: 2kmk_A, 5v3j_F, 2drp_D, 7w1m_H, 7y3l_A, 7n5w_A, 6ml4_A, 1mey_C, 8ssq_A, 8h9h_G, 7eyi_G, 2i13_A, 3gqc_A, 5yel_A, 7txc_E, 5und_A, 7ysf_A, 5k5i_A, 8cuc_F, 5kkq_D, 1ubd_C, 8ssu_A, 8gn3_A, 5kl3_A, 7y3m_I, 5yj3_D, 4x9j_A, 1llm_D
Binding Motifs: fru_SANGER_10_FBgn0004652 mmmcsrmAGTAAyA
fru_SOLEXA_5_FBgn0004652 cmcmmmmcmcrmAGTAAyammmmm
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.