Transcription Factor
| Accessions: | 3g6r_A (3D-footprint 20260701), 3g8u_A (3D-footprint 20260701), 3g99_A (3D-footprint 20260701), 3g9i_A (3D-footprint 20260701), 3g9j_B (3D-footprint 20260701) |
| Names: | GCR_RAT, Glucocorticoid receptor, GR, Nuclear receptor subfamily 3 group C member 1 |
| Organisms: | Rattus norvegicus |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P06536 |
| Length: | 79 |
| Pfam Domains: | 3-70 Zinc finger, C4 type (two domains) |
| Sequence: (in bold interface residues) | 1 SHMCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACR 60 61 YRKCLQAGMNLEARKTKKK |
| Interface Residues: | 12, 13, 15, 16, 22, 23, 25, 26, 29, 30, 54, 78 |
| 3D-footprint Homologues: | 6fbq_A, 6l6q_B, 7wnh_D, 1a6y_A, 1lo1_A, 3g9m_B, 4oln_B, 2a66_A, 8hbm_B, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 7xvn_C, 4iqr_B, 2han_A, 1hcq_E, 8cef_H, 5krb_G, 2han_B, 1kb2_B, 4tnt_B, 5e69_A, 4hn5_B, 8rm6_A, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A, 5cbz_E |
| Binding Motifs: | 3g99_AB aCakkdtGtkc 3g9j_AB CaGnACAnnnTGtnC 3g6r_AB GnnCAnnnTGTnC 3g8u_AB GaaCAnnnGGTnC 3g9i_AB ghaCandntGttc 3g9j_B TGTnCtg |
| Binding Sites: | 3g9j_C 3g9j_D |
| Publications: | Meijsing S.H, Pufall M.A, So A.Y, Bates D.L, Chen L, Yamamoto K.R. DNA binding site sequence directs glucocorticoid receptor structure and activity. Science (New York, N.Y.) 324:407-10 (2009). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.