Transcription Factor

Accessions: PROP1_full (HumanTF 1.0)
Names: Homeobox protein prophet of Pit-1, Pituitary-specific homeodomain factor, PROP-1, PROP1, PROP1_HUMAN
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Uniprot: O75360
Notes: Ensembl ID: ENSG00000175325; Full protein sequence; TF family: homeodomain; Clone source: hORFeome
Length: 227
Pfam Domains: 70-126 Homeobox domain
93-122 Homeobox KN domain
Sequence:
(in bold interface residues)
1 MEAERRRQAEKPKKGRVGSNLLPERHPATGTPTTTVDSSAPPCRRLPGAGGGRSRFSPQG 60
61 GQRGRPHSRRRHRTTFSPVQLEQLESAFGRNQYPDIWARESLARDTGLSEARIQVWFQNR 120
121 RAKQRKQERSLLQPLAHLSPAAFSSFLPESTACPYSYAAPPPPVTCFPHPYSHALPSQPS 180
181 TGGAFALSHQSEDWYPTLHPAPAGHLPCPPPPPMLPLSLEPSKSWN*
Interface Residues: 69, 70, 71, 72, 73, 111, 112, 114, 115, 118, 119, 122, 123, 126, 129, 130
3D-footprint Homologues: 4j19_B, 1ig7_A, 5zfz_A, 2h1k_B, 1puf_A, 3cmy_A, 1mnm_C, 6a8r_A, 3d1n_M, 1fjl_B, 3lnq_A, 2lkx_A, 1jgg_B, 1nk2_P, 1zq3_P, 2ld5_A, 1le8_B, 1k61_B, 7q3o_C, 6es3_K, 3a01_E, 6m3d_C, 5flv_I, 5zjt_E, 2hdd_A, 7psx_B, 5hod_A, 3rkq_B, 2r5y_A, 1puf_B, 1au7_A, 2hos_A, 5jlw_D, 4cyc_A, 1b72_A, 4xrs_G, 3l1p_A, 7xrc_C, 1e3o_C, 2xsd_C, 1le8_A, 1o4x_A, 1du0_A, 8g87_X, 4qtr_D, 4xrm_B
Binding Motifs: PROP1_full TAAtyyaATTA
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.