Transcription Factor

Accessions: PDX1_DBD (HumanTF 1.0), PDX1 (HT-SELEX2 May2017)
Names: Glucose-sensitive factor, GSF, IDX-1, Insulin promoter factor 1, Insulin upstream factor 1, IPF-1, Islet/duodenum homeobox-1, IUF-1, Pancreas/duodenum homeobox protein 1, PDX-1, PDX1, PDX1_HUMAN, Somatostatin-transactivating factor 1, STF-1, ENSG00000139515
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HT-SELEX2 May2017 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: P52945
Notes: Ensembl ID: ENSG00000139515; DNA-binding domain sequence; TF family: homeodomain; Clone source: Synt_2, TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2
Length: 131
Pfam Domains: 49-105 Homeobox domain
Sequence:
(in bold interface residues)
1 PFPEGAEPGVLEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYAAEPEENKRTRTAYTRAQL 60
61 LELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRGGGTAVGGG 120
121 GVAEPEQDCAV
Interface Residues: 21, 25, 49, 50, 51, 52, 90, 91, 93, 94, 97, 98, 100, 101, 102, 105
3D-footprint Homologues: 1au7_A, 3d1n_M, 6a8r_A, 1fjl_B, 5zfz_A, 3cmy_A, 8ejp_B, 1puf_A, 8pmf_A, 3lnq_A, 1nk2_P, 1zq3_P, 2lkx_A, 6m3d_C, 1jgg_B, 2hos_A, 8eml_B, 1puf_B, 9b8u_A, 7q3o_C, 5jlw_D, 2ld5_A, 8ik5_C, 1b72_A, 6es3_K, 4xrs_G, 3a01_E, 1ig7_A, 3rkq_B, 8osb_E, 5flv_I, 2hdd_A, 5zjt_E, 4cyc_A, 2r5y_A, 7psx_B, 5hod_A, 1le8_A, 2xsd_C, 7xrc_C, 1e3o_C, 4qtr_D, 1o4x_A, 1du0_A
Binding Motifs: PDX1_DBD_1 syAATTArsrsyAATTAr
PDX1_DBD_2 symATTAr
PDX1_3 yTAATkrc
PDX1_methyl_1 yTAATkrc
PDX1_methyl_2 rTCrTTAr
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.