Transcription Factor
| Accessions: | T099687_1.02 (CISBP 1.02), G5EE18 (JASPAR 2024) |
| Names: | ceh-28, T099687_1.02;, CEH28_CAEEL, G5EE18_CAEEL, Homeobox domain-containing protein, Homeobox protein ceh-28, NK-2 family homeodomain protein CEH-28, NK-2 homeodomain factor CEH-28 |
| Organisms: | Caenorhabditis elegans |
| Libraries: | CISBP 1.02 1, JASPAR 2024 2 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | experiment type:ChIP-seq, family:Homeodomain |
| Length: | 201 |
| Pfam Domains: | 105-161 Homeobox domain |
| Sequence: (in bold interface residues) | 1 MQSTQISSTTVILPSEVIQPPQQSAVPSEFKNTLPSRLNLFEGFDQSFSELTNPYQPVIP 60 61 LMQRESLLGASSYYSSPSQNQRSYQNHRQHSNPDTINLRSQQQKRKPRVLFTQHQVNELE 120 121 ERFKKQRYVTATEREELAQCLGLTATQVKIWFQNRRYKCKRLAQDRTLQLSQIPFNPMFA 180 181 SAFPFGINSFGTAPSSSSSGS |
| Interface Residues: | 79, 80, 83, 102, 104, 105, 106, 107, 108, 146, 147, 149, 150, 153, 154, 156, 157, 158, 160, 161 |
| 3D-footprint Homologues: | 5zfz_A, 1puf_A, 4j19_B, 5zjt_E, 8ejp_B, 1fjl_B, 6a8r_A, 3cmy_A, 1ig7_A, 3d1n_M, 8pmf_A, 3lnq_A, 1nk2_P, 1zq3_P, 1au7_A, 2lkx_A, 6m3d_C, 2ld5_A, 7q3o_C, 6es3_K, 5flv_I, 9b8u_A, 3a01_E, 8ik5_C, 7psx_B, 5hod_A, 3rkq_B, 2hdd_A, 8osb_E, 1b72_A, 4cyc_A, 2r5y_A, 8eml_B, 4xrs_G, 2hos_A, 1jgg_B, 5jlw_D, 1e3o_C, 1le8_A, 7xrc_C, 2xsd_C, 8bx1_A, 4qtr_D, 1k61_B, 1o4x_A, 4xrm_B, 1mnm_C, 1du0_A, 1puf_B, 8g87_X |
| Binding Motifs: | M4717_1.02 AATCGATw MA1445.1 wwATCGATww |
| Binding Sites: | MA1445.1.1 / MA1445.1.19 / MA1445.1.9 MA1445.1.10 / MA1445.1.2 / MA1445.1.20 MA1445.1.11 / MA1445.1.14 / MA1445.1.16 / MA1445.1.4 / MA1445.1.5 / MA1445.1.8 MA1445.1.12 / MA1445.1.13 / MA1445.1.15 / MA1445.1.3 / MA1445.1.6 / MA1445.1.7 MA1445.1.17 MA1445.1.18 |
| Publications: | Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.