Transcription Factor

Accessions: 1egw_B (3D-footprint 20231221)
Names: MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A, MEF2A_HUMAN, Myocyte-specific enhancer factor 2A, Serum response factor-like protein 1
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q02078
Length: 72
Pfam Domains: 9-58 SRF-type transcription factor (DNA-binding and dimerisation domain)
Sequence:
(in bold interface residues)
1 GRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTD 60
61 MDKVLLKYTEYN
Interface Residues: 2, 3, 14, 17, 18, 22
3D-footprint Homologues: 1n6j_A, 1c7u_A, 7x1n_C, 1hbx_A, 1mnm_A
Binding Motifs: 1egw_AB CTannnnTAg
Binding Sites: 1egw_E
1egw_F
Publications: Santelli E, Richmond T.J. Crystal structure of MEF2A core bound to DNA at 1.5 A resolution. Journal of molecular biology 297:437-49 (2000). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.