Transcription Factor

Accessions: 2kae_A (3D-footprint 20231221)
Names: GATA-type transcription factor
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q9GSP3
Length: 56
Pfam Domains: 4-38 GATA zinc finger
Sequence:
(in bold interface residues)
1 SFQCSNCSVTETIRWRNIRSKEGIQCNACFIYQRKYNKTRPVTAVNKYQKRKLKVQ
Interface Residues: 13, 14, 16, 27, 31, 32, 35
3D-footprint Homologues: 3vd6_C, 1gat_A, 3dfx_B, 4gat_A
Binding Motifs: 2kae_A AGTATACTTT
Binding Sites: 2kae_B / 2kae_C
Publications: Lowry J.A, Gamsjaeger R, Thong S.Y, Hung W, Kwan A.H, Broitman-Maduro G, Matthews J.M, Maduro M, Mackay J.P. Structural analysis of MED-1 reveals unexpected diversity in the mechanism of DNA recognition by GATA-type zinc finger domains. The Journal of biological chemistry 284:5827-35 (2009). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.