Transcription Factor
Accessions: | 2kae_A (3D-footprint 20231221) |
Names: | GATA-type transcription factor |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | Q9GSP3 |
Length: | 56 |
Pfam Domains: | 4-38 GATA zinc finger |
Sequence: (in bold interface residues) | 1 SFQCSNCSVTETIRWRNIRSKEGIQCNACFIYQRKYNKTRPVTAVNKYQKRKLKVQ |
Interface Residues: | 13, 14, 16, 27, 31, 32, 35 |
3D-footprint Homologues: | 3vd6_C, 1gat_A, 3dfx_B, 4gat_A |
Binding Motifs: | 2kae_A AGTATACTTT |
Binding Sites: | 2kae_B / 2kae_C |
Publications: | Lowry J.A, Gamsjaeger R, Thong S.Y, Hung W, Kwan A.H, Broitman-Maduro G, Matthews J.M, Maduro M, Mackay J.P. Structural analysis of MED-1 reveals unexpected diversity in the mechanism of DNA recognition by GATA-type zinc finger domains. The Journal of biological chemistry 284:5827-35 (2009). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.