Transcription Factor
| Accessions: | 4lll_A (3D-footprint 20260701), 4lll_B (3D-footprint 20260701), 4lll_C (3D-footprint 20260701), 4lll_J (3D-footprint 20260701), 4lln_B (3D-footprint 20260701) |
| Names: | MarR family HTH-type transcriptional regulator mepR, MarR family regulatory protein, MarR family transcriptional regulator, MepA/mepB repressor and autoregulator, MepR, Multidrug efflux MATE transporter transcriptional repressor MepR, Multidrug efflux transporter transcriptional repressor MepR, Q5Y812_STAAU, Transcriptional regulator SlyA, Transcriptional regulator, MarR family |
| Organisms: | Staphylococcus aureus |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q5Y812 |
| Length: | 138 |
| Pfam Domains: | 27-87 MarR family 29-87 MarR family 29-96 Winged helix DNA-binding domain 43-76 Winged helix-turn-helix DNA-binding |
| Sequence: (in bold interface residues) | 1 EFTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTG 60 61 PTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSE 120 121 EENEQMKANLTKMLSSLQ |
| Interface Residues: | 50, 59, 60, 61, 62, 64, 65, 68, 69, 86 |
| 3D-footprint Homologues: | 7el3_B, 5k98_B, 3dnv_B, 6fix_D, 2isz_B, 1ddn_B, 1f5t_A, 4lln_I, 7dvv_A, 1u8r_B, 5hlg_E |
| Binding Motifs: | 4lll_AB TTnnnTAgAnnTCTAAnnA 4lll_CD TnntTAnnnnTCTAannAA 4lll_IJ TTnnTTAGAnntCTAA 4lll_J cTAa 4lln_AB TTnnTTAgAnnTcTAAnnAAA |
| Binding Sites: | 4lll_G / 4lll_H / 4lll_K / 4lll_L / 4lln_G / 4lln_H |
| Publications: | Birukou I, Seo S.M, Schindler B.D, Kaatz G.W, Brennan R.G. Structural mechanism of transcription regulation of the Staphylococcus aureus multidrug efflux operon mepRA by the MarR family repressor MepR. Nucleic acids research 42:2774-88 (2014). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.