Transcription Factor

Accessions: CG32830 (FlyZincFinger 1.0 )
Names: CG32830
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 77
Pfam Domains: 4-24 C2H2-type zinc finger
31-55 Zinc finger, C2H2 type
32-54 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 YMLPCPLCETPLEQRVFRQHLDRHYPRDSPVCPVIECGRRFAHPNSVRNHMRIKHTLQWA 60
61 KMKAMRSSGGPFAGGPD
Interface Residues: 13, 14, 15, 16, 17, 19, 20, 42, 43, 44, 45, 46, 48, 49
3D-footprint Homologues: 7ysf_A, 7eyi_G, 8h9h_G, 7txc_E, 2i13_A, 1mey_C, 7n5w_A, 2gli_A, 6wmi_A, 6ml4_A, 1llm_D, 4x9j_A, 1f2i_J, 1ubd_C, 1g2f_F
Binding Motifs: CG32830_SANGER_10_FBgn0052830 mGGAAGTr
CG32830_SOLEXA_5_FBgn0052830 kkkkkkkaTTAATcrktkkkkkgs
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.