Transcription Factor

Accessions: 1by4_B (3D-footprint 20260701)
Names: Nuclear receptor subfamily 2 group B member 1, RETINOIC ACID RECEPTOR RXR-ALPHA, Retinoid X receptor alpha, RXRA_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P19793
Length: 82
Pfam Domains: 7-75 Zinc finger, C4 type (two domains)
Sequence:
(in bold interface residues)
1 GSFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRC 60
61 QYCRYQKCLAMGMKREAVQEER
Interface Residues: 16, 17, 19, 20, 26, 27, 29, 30, 33, 34, 58, 80, 82
3D-footprint Homologues: 6fbq_A, 6l6q_B, 7wnh_D, 1lo1_A, 3g9m_B, 1a6y_A, 4oln_B, 1dsz_A, 4umm_E, 3cbb_A, 7xvn_C, 4iqr_B, 2han_A, 1hcq_E, 8cef_H, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 8hbm_B, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 8rm6_A, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A, 5cbz_E, 4tnt_B, 5e69_A, 4hn5_B
Binding Motifs: 1by4_B tGaCC
1by4_BC GGTCAnnnGGTCA
Binding Sites: 1by4_E / 1by4_G
1by4_F / 1by4_H
Publications: Zhao Q, Chasse S.A, Devarakonda S, Sierk M.L, Ahvazi B, Rastinejad F. Structural basis of RXR-DNA interactions. Journal of molecular biology 296:509-20 (2000). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.