Transcription Factor

						

			
Accessions: 1awc_A (3D-footprint 20231221)

			
Names: GA BINDING PROTEIN ALPHA, GA-binding protein alpha chain, GABP subunit alpha, GABPA_MOUSE
Organisms: Mus musculus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q00422
Length: 110
Pfam Domains:      1-82 Ets-domain
Sequence: 
(in bold interface residues)		   1 IQLWQFLLELLTDKDARDCISWVGDEGEFKLNQPELVAQKWGQRKNKPTMNYEKLSRALR   60
  61 YYYDGDMICKVQGKRFVYKFVCDLKTLIGYSAAELNRLVIECEQKKLARM
Interface Residues: 53, 54, 56, 57, 58, 60, 61, 75
3D-footprint Homologues: 4mhg_A, 2stt_A, 4uno_A, 3jtg_A, 1dux_F, 7jsa_J, 3zp5_A, 8ee9_F, 4iri_A, 1bc8_C, 4l18_B, 4lg0_B, 1yo5_C, 4bqa_A, 1awc_A
Binding Motifs: 1awc_A cGGAAg
Binding Sites: 1awc_D
1awc_E
			
Publications: Batchelor A.H, Piper D.E, de la Brousse F.C, McKnight S.L, Wolberger C. The structure of GABPalpha/beta: an ETS domain- ankyrin repeat heterodimer bound to DNA. Science (New York, N.Y.) 279:1037-41 (1998). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.