Transcription Factor
Accessions: | 1awc_A (3D-footprint 20231221) |
Names: | GA BINDING PROTEIN ALPHA, GA-binding protein alpha chain, GABP subunit alpha, GABPA_MOUSE |
Organisms: | Mus musculus |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | Q00422 |
Length: | 110 |
Pfam Domains: | 1-82 Ets-domain |
Sequence: (in bold interface residues) | 1 IQLWQFLLELLTDKDARDCISWVGDEGEFKLNQPELVAQKWGQRKNKPTMNYEKLSRALR 60 61 YYYDGDMICKVQGKRFVYKFVCDLKTLIGYSAAELNRLVIECEQKKLARM |
Interface Residues: | 53, 54, 56, 57, 58, 60, 61, 75 |
3D-footprint Homologues: | 8ee9_F, 4mhg_A, 2stt_A, 4uno_A, 3jtg_A, 1dux_F, 7jsa_J, 3zp5_A, 4lg0_B, 1yo5_C, 4bqa_A, 1awc_A, 4iri_A, 1bc8_C, 4l18_B |
Binding Motifs: | 1awc_A cGGAAg |
Binding Sites: | 1awc_D 1awc_E |
Publications: | Batchelor A.H, Piper D.E, de la Brousse F.C, McKnight S.L, Wolberger C. The structure of GABPalpha/beta: an ETS domain- ankyrin repeat heterodimer bound to DNA. Science (New York, N.Y.) 279:1037-41 (1998). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.