Transcription Factor

Accessions: Q9P255 (JASPAR 2024)
Names: Zinc finger protein 115, Zinc finger protein 492, ZN492_HUMAN
Organisms: Homo sapiens
Libraries: JASPAR 2024 1
1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Uniprot: Q9P255
Length: 531
Pfam Domains: 128-150 Zinc-finger double domain
141-163 C2H2-type zinc finger
141-163 Zinc finger, C2H2 type
155-179 Zinc-finger double domain
168-189 C2H2-type zinc finger
169-191 C2H2-type zinc finger
169-191 Zinc finger, C2H2 type
183-207 Zinc-finger double domain
196-216 C2H2-type zinc finger
197-219 Zinc finger, C2H2 type
197-219 C2H2-type zinc finger
211-235 Zinc-finger double domain
224-245 C2H2-type zinc finger
225-247 Zinc finger, C2H2 type
225-247 C2H2-type zinc finger
239-263 Zinc-finger double domain
252-272 C2H2-type zinc finger
253-275 Zinc finger, C2H2 type
253-273 C2H2-type zinc finger
268-291 Zinc-finger double domain
280-300 C2H2-type zinc finger
281-303 Zinc finger, C2H2 type
281-303 C2H2-type zinc finger
296-319 Zinc-finger double domain
309-331 C2H2-type zinc finger
309-331 Zinc finger, C2H2 type
309-331 C2H2-type zinc finger
323-348 Zinc-finger double domain
336-357 C2H2-type zinc finger
337-359 Zinc finger, C2H2 type
337-359 C2H2-type zinc finger
352-376 Zinc-finger double domain
365-385 C2H2-type zinc finger
365-387 Zinc finger, C2H2 type
365-387 C2H2-type zinc finger
379-402 Zinc-finger double domain
392-412 C2H2-type zinc finger
393-415 C2H2-type zinc finger
393-415 Zinc finger, C2H2 type
408-431 Zinc-finger double domain
420-440 C2H2-type zinc finger
421-443 Zinc finger, C2H2 type
421-440 C2H2-type zinc finger
436-459 Zinc-finger double domain
453-471 Zinc finger, C2H2 type
454-469 C2H2-type zinc finger
463-488 Zinc-finger double domain
476-496 C2H2-type zinc finger
477-499 Zinc finger, C2H2 type
477-497 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 MLENYRNLVFVGIAASKPDLITCLEQGKEPWNVKRHEMVAEPPVVCSYFARDLWPKQGKK 60
61 NYFQKVILRRYKKCGCENLQLRKYCKSMDECKVHKECYNGLNQCLTTTQNKIFQCDKYVK 120
121 VFHKFSNSNRHTIRHTGKKSFKCKECEKSFCMLSHLAQHKRIHSGEKPYKCKECGKAYNE 180
181 TSNLSTHKRIHTGKKPYKCEECGKAFNRLSHLTTHKIIHTGKKPYKCEECGKAFNQSANL 240
241 TTHKRIHTGEKPYKCEECGRAFSQSSTLTAHKIIHAGEKPYKCEECGKAFSQSSTLTTHK 300
301 IIHTGEKFYKCEECGKAFSQLSHLTTHKRIHSGEKPYKCEECGKAFKQSSTLTTHKRIHA 360
361 GEKFYKCEVCSKAFSRFSHLTTHKRIHTGEKPYKCEECGKAFNLSSQLTTHKIIHTGEKP 420
421 YKCEECGKAFNQSSTLSKHKVIHTGEKPYKYEECGKAFNQSSHLTTHKMIHTGEKPYKCE 480
481 ECGKAFNNSSILNRHKMIHTGEKLYKPESCNNACDNIAKISKYKRNCAGEK
Interface Residues: 151, 152, 154, 155, 158, 162, 169, 179, 180, 181, 182, 183, 186, 187, 190, 207, 208, 209, 210, 211, 212, 213, 214, 215, 218, 235, 236, 237, 238, 239, 242, 245, 263, 264, 265, 266, 267, 269, 270, 292, 293, 294, 295, 298, 319, 320, 321, 322, 323, 325, 326, 328, 329, 332, 348, 350, 351, 354, 360, 374, 375, 376, 377, 378, 379, 381, 382, 386, 403, 404, 405, 406, 407, 408, 410, 431, 432, 433, 434, 435, 437, 438, 460, 462, 463, 466
3D-footprint Homologues: 6jnm_A, 7w1m_H, 6blw_A, 8ssu_A, 6a57_A, 2kmk_A, 1tf3_A, 5ei9_F, 2drp_D, 5kkq_D, 1tf6_A, 4m9v_C, 8ssq_A, 5yj3_D, 5kl3_A, 7ysf_A, 3uk3_C, 8cuc_F, 7y3l_A, 1g2f_F, 5v3j_F, 5k5i_A, 1llm_D, 6u9q_A, 2wbs_A, 6e94_A, 7y3m_I, 7txc_E, 1ubd_C, 5yel_A, 2jpa_A, 4x9j_A, 2gli_A, 1f2i_J, 7n5w_A, 6ml4_A, 8h9h_G, 2lt7_A, 8gn3_A
Binding Motifs: UN0622.1 AGArcAmyAAAARGG
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.