Transcription Factor
| Accessions: | 2han_B (3D-footprint 20250804) |
| Names: | 20-hydroxy-ecdysone receptor, 20E receptor, Ecdysone receptor, Ecdysteroid receptor, ECR_DROME, EcRH, Nuclear receptor subfamily 1 group H member 1 |
| Organisms: | Drosophila melanogaster |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P34021 |
| Length: | 87 |
| Pfam Domains: | 6-73 Zinc finger, C4 type (two domains) |
| Sequence: (in bold interface residues) | 1 RVQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYCCKFGRACEMDMYMRRKCQ 60 61 ECRLKKCLAVGMRPECVVPENQCAMKR |
| Interface Residues: | 15, 16, 18, 19, 25, 26, 28, 29, 32, 33, 57, 86 |
| 3D-footprint Homologues: | 6fbq_A, 6l6q_B, 7wnh_D, 3g9m_B, 1a6y_A, 1lo1_A, 4oln_B, 2a66_A, 8hbm_B, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 7xvn_C, 4iqr_B, 2han_A, 1hcq_E, 8cef_H, 5krb_G, 2han_B, 1kb2_B, 5cbz_E, 4tnt_B, 5e69_A, 4hn5_B, 8rm6_A, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A |
| Binding Motifs: | 2han_AB GGTTCAnTncaC |
| Binding Sites: | 2han_C 2han_D |
| Publications: | Jakób M, Kołodziejczyk R, Orłowski M, Krzywda S, Kowalska A, Dutko-Gwóźdź J, Gwóźdź T, Kochman M, Jaskólski M, Ozyhar A. Novel DNA-binding element within the C-terminal extension of the nuclear receptor DNA-binding domain. Nucleic acids research 35:2705-18 (2007). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.