Transcription Factor

Accessions: 2han_B (3D-footprint 20250804)
Names: 20-hydroxy-ecdysone receptor, 20E receptor, Ecdysone receptor, Ecdysteroid receptor, ECR_DROME, EcRH, Nuclear receptor subfamily 1 group H member 1
Organisms: Drosophila melanogaster
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P34021
Length: 87
Pfam Domains: 6-73 Zinc finger, C4 type (two domains)
Sequence:
(in bold interface residues)
1 RVQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYCCKFGRACEMDMYMRRKCQ 60
61 ECRLKKCLAVGMRPECVVPENQCAMKR
Interface Residues: 15, 16, 18, 19, 25, 26, 28, 29, 32, 33, 57, 86
3D-footprint Homologues: 6fbq_A, 7wnh_D, 6l6q_B, 3g9m_B, 1a6y_A, 1lo1_A, 4oln_B, 2han_A, 1hcq_E, 8cef_H, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 8hbm_B, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 7xvn_C, 4iqr_B, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A, 5cbz_E, 4tnt_B, 5e69_A, 4hn5_B, 8rm6_A, 5emc_A
Binding Motifs: 2han_AB GGTTCAnTncaC
Binding Sites: 2han_C
2han_D
Publications: Jakób M, Kołodziejczyk R, Orłowski M, Krzywda S, Kowalska A, Dutko-Gwóźdź J, Gwóźdź T, Kochman M, Jaskólski M, Ozyhar A. Novel DNA-binding element within the C-terminal extension of the nuclear receptor DNA-binding domain. Nucleic acids research 35:2705-18 (2007). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.