Transcription Factor

Accessions: SRY (SMILE-seq 1.0)
Names: Na(+)/H(+) exchange regulatory cofactor NHE-RF2, NHE3 kinase A regulatory protein E3KARP, NHERF-2, NHRF2_HUMAN, SIP-1, Sodium-hydrogen exchanger regulatory factor 2, Solute carrier family 9 isoform A3 regulatory factor 2, SRY, SRY-interacting protein 1, TKA-1, Tyrosine kinase activator protein 1
Organisms: Homo sapiens
Libraries: SMILE-seq 1.0 1
1 Isakova A, Groux R, Imbeault M, Rainer P, Alpern D, Dainese R, Ambrosini G, Trono D, Bucher P, Deplancke B. SMiLE-seq identifies binding motifs of single and dimeric transcription factors. Nat Methods 14:316-322 (2017). [Pubmed]
Uniprot: Q15599
Notes: TF family: HMG
Length: 203
Pfam Domains: 59-118 Domain of unknown function (DUF1898)
60-128 HMG (high mobility group) box
Sequence:
(in bold interface residues)
1 MQSYASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGENSKGNVQDRV 60
61 KRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMH 120
121 REKYPNYKYRPRRKAKMLPKNCSLLPADPASVLCSEVQLDNRLYRDDCTKATHSRMEHQL 180
181 GHLPPINAASSPQQRDRYSHWTK
Interface Residues: 62, 65, 67, 68, 71, 75, 86, 87, 88, 91, 129, 131, 132, 133, 135, 145, 150, 151, 154
3D-footprint Homologues: 7m5w_A, 3f27_D, 4s2q_D, 1qrv_A, 3tmm_A, 4y60_C, 2gzk_A, 1j5n_A, 6jrp_D, 2lef_A, 3u2b_C, 1o4x_B, 1hry_A, 3tq6_B
Binding Motifs: SRY aACAATrr
Publications: Isakova A, Groux R, Imbeault M, Rainer P, Alpern D, Dainese R, Ambrosini G, Trono D, Bucher P, Deplancke B. SMiLE-seq identifies binding motifs of single and dimeric transcription factors. Nat Methods 14:316-322 (2017). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.