Transcription Factor

Accessions: 6pax_A (3D-footprint 20231221)
Names: Aniridia type II protein, HOMEOBOX PROTEIN PAX-6, Oculorhombin, Paired box protein Pax-6, PAX6_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P26367
Length: 133
Pfam Domains: 1-125 'Paired box' domain
Sequence:
(in bold interface residues)
1 SHSGVNQLGGVFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILGRYYAT 60
61 GSIRPRAIGGSKPRVATPEVVSKIAQYKQECPSIFAWEIRDRLLSEGVCTNDNIPSVSSI 120
121 NRVLRNLASEKQQ
Interface Residues: 14, 46, 47, 49, 51, 52, 68, 71, 74, 116, 117, 118, 119, 121, 122, 125
3D-footprint Homologues: 1pdn_C, 6pax_A, 1k78_A
Binding Motifs: 6pax_A ACGcAnnCGTGC
Binding Sites: 6pax_B
6pax_C
Publications: Xu H.E, Rould M.A, Xu W, Epstein J.A, Maas R.L, Pabo C.O. Crystal structure of the human Pax6 paired domain-DNA complex reveals specific roles for the linker region and carboxy-terminal subdomain in DNA binding. Genes & development 13:1263-75 (1999). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.