Transcription Factor

						

			
Accessions: 4s0h_B (3D-footprint 20231221), 4s0h_F (3D-footprint 20231221), 6wc2_N (3D-footprint 20231221)

			
Names: Cardiac-specific homeobox, Homeobox protein CSX, Homeobox protein NK-2 homolog E, Homeobox protein Nkx-2.5, NKX25_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P52952
Length: 53
Pfam Domains:      1-53 Homeobox domain
Sequence: 
(in bold interface residues)		   1 RVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKSK
Interface Residues: 1, 39, 40, 42, 43, 46, 47, 50, 51
3D-footprint Homologues: 7q3o_C, 1fjl_B, 5jlw_D, 4cyc_A, 2h1k_B, 6es3_K, 1b72_A, 4xrs_G, 2ld5_A, 1puf_A, 1ig7_A, 5zfz_A, 3a01_E, 6m3d_C, 5flv_I, 3lnq_A, 2lkx_A, 1jgg_B, 3cmy_A, 2hdd_A, 1nk2_P, 7psx_B, 5hod_A, 3rkq_B, 2r5y_A, 6a8r_A, 1au7_A, 3d1n_M, 2hos_A, 2xsd_C, 1le8_A, 7xrc_C, 4j19_B, 2h8r_B, 1e3o_C, 1o4x_A, 3l1p_A, 1mnm_C, 1du0_A, 1puf_B, 8g87_X, 5zjt_E, 4qtr_D, 1zq3_P, 1k61_B, 4xrm_B
Binding Motifs: 4s0h_AB CacnnnnGAAGnG
4s0h_EF CACnnnnnAAGTG
4s0h_F aAGtG
6wc2_IJN CTAnnnnnnGAAAAnGC
Binding Sites: 4s0h_C / 4s0h_G
4s0h_D / 4s0h_H
6wc2_E
6wc2_F
			
Publications: Pradhan L, Gopal S, Li S, Ashur S, Suryanarayanan S, Kasahara H, Nam HJ. Intermolecular Interactions of Cardiac Transcription Factors NKX2. 5 and TBX5 55:1702-10 (Biochemistry.). [Pubmed]


Lei X, Zhao J, Sagendorf JM, Rajashekar N, Xu J, Dantas Machado AC, Sen C, Rohs R, Feng P, Chen L. Crystal Structures of Ternary Complexes of MEF2 and NKX2-5 Bound to DNA Reveal a Disease Related Protein-Protein Interaction Interface. J Mol Biol 432:5499-5508 (2020). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.