Transcription Factor
| Accessions: | 1g2d_F (3D-footprint 20231221) |
| Names: | Early growth response protein 1, EGR-1, EGR1_MOUSE, Nerve growth factor-induced protein A, NGFI-A, TATA BOX ZINC FINGER PROTEIN, Transcription factor Zif268, Zinc finger protein Krox-24 |
| Organisms: | Mus musculus |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P08046 |
| Length: | 88 |
| Pfam Domains: | 5-29 C2H2-type zinc finger 5-29 Zinc finger, C2H2 type 21-45 Zinc-finger double domain 35-57 C2H2-type zinc finger 35-57 Zinc finger, C2H2 type 50-74 Zinc-finger double domain 63-81 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 MERPYACPVESCDRRFSQKTNLDTHIRIHTGQKPFQCRICMRNFSQHTGLNQHIRTHTGE 60 61 KPFACDICGRKFATLHTRDRHTKIHLRQ |
| Interface Residues: | 17, 18, 19, 20, 21, 23, 24, 45, 46, 47, 48, 49, 51, 52, 53, 63, 73, 74, 75, 76, 77, 78, 79, 80, 81 |
| 3D-footprint Homologues: | 6ml4_A, 7n5w_A, 3uk3_C, 1tf3_A, 6jnm_A, 5und_A, 4x9j_A, 2i13_A, 5k5l_F, 8ssu_A, 1ubd_C, 5ei9_F, 2jpa_A, 1mey_C, 6blw_A, 5kkq_D, 1f2i_J, 6u9q_A, 2kmk_A, 5kl3_A, 2gli_A, 7ysf_A, 1g2f_F, 6wmi_A, 8ssq_A, 1tf6_A, 7w1m_H, 7eyi_G, 5v3j_F, 8h9h_G, 6e94_A, 2lt7_A, 6a57_A, 8cuc_F, 7y3l_A, 1llm_D, 2wbs_A, 2drp_D, 5yel_A, 7txc_E, 5k5i_A, 4m9v_C, 7y3m_I, 8gn3_A, 5hso_A, 5yj3_D |
| Binding Motifs: | 1g2d_F CGCTATAAAAm |
| Binding Sites: | 1g2d_D 1g2d_E |
| Publications: | Wolfe S.A, Grant R.A, Elrod-Erickson M, Pabo C.O. Beyond the "recognition code": structures of two Cys2His2 zinc finger/TATA box complexes. Structure (London, England : 1993) 9:717-23 (2001). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.