Transcription Factor

Accessions: 1g2d_F (3D-footprint 20241219)
Names: Early growth response protein 1, EGR-1, EGR1_MOUSE, Nerve growth factor-induced protein A, NGFI-A, TATA BOX ZINC FINGER PROTEIN, Transcription factor Zif268, Zinc finger protein Krox-24
Organisms: Mus musculus
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P08046
Length: 88
Pfam Domains: 5-29 Zinc finger, C2H2 type
5-29 C2H2-type zinc finger
21-45 Zinc-finger double domain
35-57 Zinc finger, C2H2 type
35-57 C2H2-type zinc finger
50-74 Zinc-finger double domain
63-81 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 MERPYACPVESCDRRFSQKTNLDTHIRIHTGQKPFQCRICMRNFSQHTGLNQHIRTHTGE 60
61 KPFACDICGRKFATLHTRDRHTKIHLRQ
Interface Residues: 17, 18, 19, 20, 21, 23, 24, 45, 46, 47, 48, 49, 51, 52, 73, 74, 75, 76, 77, 79, 80
3D-footprint Homologues: 1tf3_A, 7n5w_A, 8ssu_A, 2gli_A, 1tf6_A, 2jpa_A, 7ysf_A, 1ubd_C, 8ssq_A, 7w1m_H, 2kmk_A, 6u9q_A, 5v3j_F, 8h9h_G, 2lt7_A, 6e94_A, 7y3l_A, 8cuc_F, 7txc_E, 2drp_D, 7y3m_I, 8gn3_A
Binding Motifs: 1g2d_F CGCTATAAAAm
Binding Sites: 1g2d_D
1g2d_E
Publications: Wolfe S.A, Grant R.A, Elrod-Erickson M, Pabo C.O. Beyond the "recognition code": structures of two Cys2His2 zinc finger/TATA box complexes. Structure (London, England : 1993) 9:717-23 (2001). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.