Transcription Factor
| Accessions: | AtSPL3 (Athamap 20091028) |
| Names: | AtSPL3 |
| Organisms: | Arabidopsis thaliana |
| Libraries: | Athamap 20091028 1 1 Bulow L, Engelmann S, Schindler M, Hehl R. AthaMap, integrating transcriptional and post-transcriptional data. Nucleic acids research 37:D983-6 (2009). [Pubmed] |
| Length: | 129 |
| Pfam Domains: | 51-128 SBP domain |
| Sequence: | MRRSKAEGKRSLRELSEEEEEEEETEDEDTFEEEEALEKKQKGKATSSSGVCQVESCTAD MSKAKQYHKRHKVCQFHAKAPHVRISGLHQRFCQQCSRFHALSEFDEAKRSCRRRLAGHN ERRRKSTTD |
| Binding Motifs: | AtSPL3 dtwdmCGTACwwywwh |
| Publications: | Birkenbihl RP, Jach G, Saedler H, Huijser P. 2005. Functional dissection of the plant-specific SBP-domain: overlap of the DNA-binding and nuclear localization domains. J Mol Biol 352: 585-96. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.