Transcription Factor

Accessions: Q9FNV9 (JASPAR 2024), T05528 (AthalianaCistrome v4_May2016)
Names: AtMYB113, MY113_ARATH, Myb-related protein 113, Transcription factor MYB113, AT1G66370, MYB113, T05528;
Organisms: Arabidopsis thaliana
Libraries: JASPAR 2024 1, AthalianaCistrome v4_May2016 2
1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
2 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]
Notes: ecotype:Col-0, experiment type: DAP-seq, family:MYB
Length: 246
Pfam Domains: 10-57 Myb-like DNA-binding domain
13-68 Myb-like DNA-binding domain
69-111 Myb-like DNA-binding domain
69-108 Myb-like DNA-binding domain
Sequence:
(in bold interface residues)
1 MGESPKGLRKGTWTTEEDILLRQCIDKYGEGKWHRVPLRTGLNRCRKSCRLRWLNYLKPS 60
61 IKRGKLCSDEVDLVLRLHKLLGNRWSLIAGRLPGRTANDVKNYWNTHLSKKHDERCCKTK 120
121 MINKNITSHPTSSAQKIDVLKPRPRSFSDKNSCNDVNILPKVDVVPLHLGLNNNYVCESS 180
181 ITCNKDEQKDKLININLLDGDNMWWESLLEADVLGPEATETAKGVTLPLDFEQIWARFDE 240
241 ETLELN
Interface Residues: 10, 45, 46, 47, 48, 50, 51, 55, 56, 97, 98, 101, 102, 105, 106, 107
3D-footprint Homologues: 1vfc_A, 1w0t_A, 3osg_A, 2kdz_A, 7xur_A, 3zqc_A, 6kks_A, 1mse_C
Binding Motifs: M0552 / MA1181.1 wAkTymGTTAt
MA1181.2 AkTymGTTAt
Publications: Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.