Transcription Factor
| Accessions: | FOXJ3_TF1 (HumanTF2 1.0), FOXJ3 (HT-SELEX2 May2017) |
| Names: | FOXJ3, FOXJ3_HUMAN, ENSG00000198815 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF2 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Uniprot: | Q9UPW0 |
| Notes: | Ensembl ID: ENSG00000198815; Construct type: TF1(SBP); TF family: Forkhead; Clone source: Jolma et al. 2013, TF family: Forkhead experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: Forkhead experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4 |
| Length: | 139 |
| Pfam Domains: | 21-105 Fork head domain |
| Sequence: (in bold interface residues) | 1 ALLDPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYRE 60 61 AGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDALPTRPKKRARSVERA 120 121 STPYSIDSDSLGMECIISG |
| Interface Residues: | 18, 64, 66, 67, 68, 70, 71, 72, 74, 75, 78, 80, 81, 84, 91, 112 |
| 3D-footprint Homologues: | 7yzb_A, 7vox_H, 2hdc_A, 6nce_A, 2uzk_A, 7vou_C, 2c6y_A, 7yze_A, 7cby_C, 3co6_C, 6ako_C, 7yzg_A, 7tdw_A, 3g73_A, 7yz7_A, 6el8_A, 7tdx_A, 3l2c_A, 2a07_J, 3qrf_G, 2o4a_A |
| Binding Motifs: | FOXJ3_ELF1 rcarAAAACCGAAwmv FOXJ3_TBX21_1 arsyGtkRawarawAACAACACch FOXJ3_TBX21_2 wAACAACACct- FOXJ3_2 rcGTmAACAa FOXJ3_methyl_1 rcGTAAACAa |
| Publications: | Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.