Transcription Factor
| Accessions: | DEAR4 (ArabidopsisPBM 20140210), Q9SW63 (JASPAR 2024) |
| Names: | DEAR4, RAP2.10, Ethylene-responsive transcription factor RAP2-10, Protein RELATED TO APETALA2 10, RA210_ARATH |
| Organisms: | Arabidopsis thaliana |
| Libraries: | ArabidopsisPBM 20140210 1, JASPAR 2024 2 1 Franco-Zorrilla J.M, López-Vidriero I, Carrasco J.L, Godoy M, Vera P, Solano R. DNA-binding specificities of plant transcription factors and their potential to define target genes. Proceedings of the National Academy of Sciences of the United States of America : (2014). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | AP2/EREBP (DREB) |
| Length: | 196 |
| Pfam Domains: | 29-78 AP2 domain |
| Sequence: (in bold interface residues) | 1 METATEVATVVSTPAVTVAAVATRKRDKPYKGIRMRKWGKWVAEIREPNKRSRIWLGSYS 60 61 TPEAAARAYDTAVFYLRGPSARLNFPELLAGVTVTGGGGGGVNGGGDMSAAYIRRKAAEV 120 121 GAQVDALEAAGAGGNRHHHHHQHQRGNHDYVDNHSDYRINDDLMECSSKEGFKRCNGSLE 180 181 RVDLNKLPDPETSDDD |
| Interface Residues: | 34, 36, 37, 38, 42, 44, 46, 51, 53, 55 |
| 3D-footprint Homologues: | 7wq5_A, 1gcc_A, 5wx9_A, 7et4_D |
| Binding Motifs: | DEAR4 sCACCGACAy DEAR4_2 rGCGCCGCCt MA0980.1 GCGCCGCC MA1249.1 wwkTGTCGGCrrmrr MA0980.2 yyrCCGACAaww MA0980.3 rCCGACA |
| Binding Sites: | MA1249.1.1 MA1249.1.10 MA1249.1.11 MA1249.1.12 MA1249.1.13 MA1249.1.14 MA1249.1.15 MA1249.1.16 MA1249.1.17 MA1249.1.18 MA1249.1.19 MA1249.1.2 MA1249.1.20 MA1249.1.3 MA1249.1.4 MA1249.1.5 MA1249.1.6 MA1249.1.7 MA1249.1.8 MA1249.1.9 MA0980.2.1 MA0980.2.10 / MA0980.2.8 MA0980.2.11 / MA0980.2.9 MA0980.2.12 MA0980.2.10 / MA0980.2.13 MA0980.2.14 MA0980.2.11 / MA0980.2.15 MA0980.2.16 MA0980.2.17 MA0980.2.18 MA0980.2.12 / MA0980.2.19 MA0980.2.2 MA0980.2.13 / MA0980.2.20 MA0980.2.3 MA0980.2.4 MA0980.2.5 MA0980.2.6 MA0980.2.7 MA0980.2.7 / MA0980.2.8 MA0980.2.9 MA0980.2.14 MA0980.2.15 MA0980.2.16 MA0980.2.17 MA0980.2.18 MA0980.2.19 MA0980.2.20 MA0980.3.1 / MA0980.3.10 / MA0980.3.13 / MA0980.3.15 / MA0980.3.16 / MA0980.3.17 / MA0980.3.18 / MA0980.3.19 / MA0980.3.2 / MA0980.3.3 / MA0980.3.4 / MA0980.3.5 / MA0980.3.6 / MA0980.3.9 MA0980.3.11 / MA0980.3.12 / MA0980.3.20 / MA0980.3.7 / MA0980.3.8 MA0980.3.14 |
| Publications: | Franco-Zorrilla J.M, López-Vidriero I, Carrasco J.L, Godoy M, Vera P, Solano R. DNA-binding specificities of plant transcription factors and their potential to define target genes. Proceedings of the National Academy of Sciences of the United States of America : (2014). [Pubmed] Magnani E, Sjölander K, Hake S. From endonucleases to transcription factors: evolution of the AP2 DNA binding domain in plants. Plant Cell 16:2265-77 (2004). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.