Transcription Factor
| Accessions: | ECK120004526 (RegulonDB 7.5) |
| Names: | AraC |
| Organisms: | ECK12 |
| Libraries: | RegulonDB 7.5 1 1 Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muniz-Rascado L, Garcia-Sotelo JS, Weiss V, Solano-Lira H, Martinez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernandez S, Alquicira-Hernandez K, Lopez-Fuentes A, Porron-Sotelo L, Huerta AM, Bonavides-Martinez C, Balderas-Martinez YI, Pannier L, Olvera M, Labastida A, Jimenez-Jacinto V, Vega-Alvarado L, Del Moral-Chavez V, Hernandez-Alvarez A, Morett E, Collado-Vides J. RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more. Nucleic Acids Res. 2013 Jan 1;41(D1):D203-D213. [Pubmed] |
| Notes: | The arabinose regulator, AraC, is a transcription factor that regulates transcription of several genes and operons involved in arabinose catabolism and transport; It coregulates with another transcriptional regulator, CRP; both are transcription factors involved in l-arabinose degradation; These regulators bind cooperatively to activate transcription of five operons related to transport, catabolism, and autoregulation of l-arabinose; Transcription of these operons is induced when E. coli is grown in the absence of glucose and when the physiological inducer, l-arabinose, binds to the AraC regulator; In the absence of glucose, cellular cyclic AMP levels are high and cyclic AMP forms a dimeric complex with CRP to coregulate with AraC Gallegos MT,1997; Reeder T,1991; Stoner C,1983; Hendrickson W,1992; Seabold RR,1998; Hendrickson W,1990; Miyada CG,1984AraC binds to five target sites in the araBp region; AraC binds to the less-conserved site (-42.5) with less strength; this binding occurs only in the presence of arabinose, and it is absolutely required for expression of araBp Lobell RB,1990; Hamilton EP,1988; Lee N,1987; Martin K,1986; Carra JH,1993 AraC binding to the distal site (-123.5) has been shown to down-regulate expression of araBp and araCp Lee DH,1992; Hamilton EP,1988 In the absence of arabinose, AraC is unable to activate araBp, but it regulates its own expression by repressing araCp and araBp simultaneously Lobell RB,1990; Martin K,1986 Arabinose triggers AraC-dependent activation of araBp and relieves AraC-dependent repression of araCp Hamilton EP,1988; Martin K,1986 The araBAD operon is located upstream of araC and in the opposite direction.In the presence of arabinose, this regulator activates transcription by overlapping the -35 box of the core promoters, and the central position of the binding site is located near bp -41.5; The binding targets for AraC consist of 17-nucleotide-long direct repeat sequences that possess conserved motifs; each monomer binds to one of these conserved sequences Gallegos MT,1997; Niland P,1996 The AraC regulator belongs to the AraC/XylS family and occurs as both a monomer and a homodimer; It is composed of two domains; The solution structure of the C-terminal DNA-binding domain has been solved; It consists of two helix-turn-helix regions connected by an α-helix Rodgers ME,2009 The N-terminal domain is responsible for dimerization and L-arabinose binding Gallegos MT,1997; Gallegos MT,1993 Its crystal structure Soisson SM,1997; Soisson SM,1997reveals that the sugar molecule is bound within a β-barrel, buried by the N-terminal arm of the protein; It has been suggested that this N-terminal arm plays a key role in the regulation of the arabinose-dependent DNA-binding properties of the protein; In the absence of arabinose it interacts with the DNA-binding domain and constrains this domain, and it releases it in the presence of arabinose Soisson SM,1997; Rodgers ME,2009 This interaction appears to be affected by a mutation in the interdomain linker Seedorff J,2011.; Transcription related; repressor; activator; operon; carbon compounds; cytoplasm; sequence-specific DNA binding; arabinose catabolic process; intracellular; sequence-specific DNA binding transcription factor activity; DNA binding; transcription, DNA-dependent; regulation of transcription, DNA-dependent |
| Length: | 293 |
| Pfam Domains: | 23-160 AraC-like ligand binding domain 187-227 Bacterial regulatory helix-turn-helix proteins, AraC family 200-278 Helix-turn-helix domain 239-277 Bacterial regulatory helix-turn-helix proteins, AraC family |
| Sequence: (in bold interface residues) | 1 MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGYILNLTIRGQGVVKNQ 60 61 GREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYWHEWLNWPSIFANTGFF 120 121 RPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRRMEAINESLHPPMDNRVR 180 181 EACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGISVLSWREDQRISQAKLLLS 240 241 TTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCEEKVNDVAVKLS* |
| Interface Residues: | 207, 208, 209, 210, 212, 213, 216, 224, 258, 259, 262, 263, 267 |
| 3D-footprint Homologues: | 3w6v_A, 7vwz_G, 1zgw_A, 1xs9_A |
| Binding Motifs: | AraC TRTGkaytwhyykrCTvyk |
| Binding Sites: | ECK120012320 ECK120012323 ECK120012328 ECK120012331 ECK120012333 ECK120012335 ECK120012603 ECK120012913 ECK120012915 ECK120012990 ECK120012992 ECK120013555 ECK120015742 ECK125108641 ECK125108643 |
| Publications: | Lobell RB., Schleif RF. DNA looping and unlooping by AraC protein. Science. 250(4980):528-32 (1990). [Pubmed] Hamilton EP., Lee N. Three binding sites for AraC protein are required for autoregulation of araC in Escherichia coli. Proc Natl Acad Sci U S A. 85(6):1749-53 (1988). [Pubmed] Lee N., Francklyn C., Hamilton EP. Arabinose-induced binding of AraC protein to araI2 activates the araBAD operon promoter. Proc Natl Acad Sci U S A. 84(24):8814-8 (1987). [Pubmed] Martin K., Huo L., Schleif RF. The DNA loop model for ara repression: AraC protein occupies the proposed loop sites in vivo and repression-negative mutations lie in these same sites. Proc Natl Acad Sci U S A. 83(11):3654-8 (1986). [Pubmed] Carra JH., Schleif RF. Variation of half-site organization and DNA looping by AraC protein. EMBO J. 12(1):35-44 (1993). [Pubmed] Lee DH., Huo L., Schleif R. Repression of the araBAD promoter from araO1. J Mol Biol. 224(2):335-41 (1992). [Pubmed] Niland P., Huhne R., Muller-Hill B. How AraC interacts specifically with its target DNAs. J Mol Biol. 264(4):667-74 (1996). [Pubmed] Rodgers ME., Schleif R. Solution structure of the DNA binding domain of AraC protein. Proteins. 77(1):202-8 (2009). [Pubmed] Gallegos MT., Michan C., Ramos JL. The XylS/AraC family of regulators. Nucleic Acids Res. 21(4):807-10 (1993). [Pubmed] Soisson SM., MacDougall-Shackleton B., Schleif R., Wolberger C. The 1.6 A crystal structure of the AraC sugar-binding and dimerization domain complexed with D-fucose. J Mol Biol. 273(1):226-37 (1997). [Pubmed] Soisson SM., MacDougall-Shackleton B., Schleif R., Wolberger C. Structural basis for ligand-regulated oligomerization of AraC. Science. 276(5311):421-5 (1997). [Pubmed] Rodgers ME., Holder ND., Dirla S., Schleif R. Functional modes of the regulatory arm of AraC. Proteins. 74(1):81-91 (2009). [Pubmed] Seedorff J., Schleif R. Active role of the interdomain linker of AraC. J Bacteriol. 193(20):5737-46 (2011). [Pubmed] Gallegos MT., Schleif R., Bairoch A., Hofmann K., Ramos JL. Arac/XylS family of transcriptional regulators. Microbiol Mol Biol Rev. 61(4):393-410 (1997). [Pubmed] Reeder T., Schleif R. Mapping, sequence, and apparent lack of function of araJ, a gene of the Escherichia coli arabinose regulon. J Bacteriol. 173(24):7765-71 (1991). [Pubmed] Stoner C., Schleif R. The araE low affinity L-arabinose transport promoter. Cloning, sequence, transcription start site and DNA binding sites of regulatory proteins. J Mol Biol. 171(4):369-81 (1983). [Pubmed] Hendrickson W., Flaherty C., Molz L. Sequence elements in the Escherichia coli araFGH promoter. J Bacteriol. 174(21):6862-71 (1992). [Pubmed] Seabold RR., Schleif RF. Apo-AraC actively seeks to loop. J Mol Biol. 278(3):529-38 (1998). [Pubmed] Hendrickson W., Stoner C., Schleif R. Characterization of the Escherichia coli araFGH and araJ promoters. J Mol Biol. 215(4):497-510 (1990). [Pubmed] Miyada CG., Stoltzfus L., Wilcox G. Regulation of the araC gene of Escherichia coli: catabolite repression, autoregulation, and effect on araBAD expression. Proc Natl Acad Sci U S A. 81(13):4120-4 (1984). [Pubmed] Madar D., Dekel E., Bren A., Alon U. Negative auto-regulation increases the input dynamic-range of the arabinose system of Escherichia coli. BMC Syst Biol. 5(1):111 (2011). [Pubmed] Frato KE., Schleif RF. A DNA-assisted binding assay for weak protein-protein interactions. J Mol Biol. 394(5):805-14 (2009). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.