Transcription Factor

Accessions: 4m9v_C (3D-footprint 20241219)
Names: Zfp-57, ZFP57_MOUSE, Zinc finger protein 57
Organisms: Mus musculus
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q8C6P8
Length: 60
Pfam Domains: 6-28 Zinc finger, C2H2 type
7-28 C2H2-type zinc finger
20-43 Zinc-finger double domain
35-56 Zinc finger, C2H2 type
36-56 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 PSERPFFCNFCGKTYRDASGLSRHRRAHLGYRPRSCPECGKCFRDQSQVNRHLKVHQNKP 60
Interface Residues: 14, 16, 17, 18, 19, 20, 22, 23, 27, 30, 31, 44, 45, 46, 47, 48, 50, 51, 55
3D-footprint Homologues: 8gn3_A, 1yuj_A, 2kmk_A, 1tf3_A, 8cuc_F, 7y3l_A, 7n5w_A, 8ssu_A, 5v3j_F, 7txc_E, 2jpa_A, 7ysf_A, 8h9h_G, 7w1m_H, 6u9q_A, 2drp_D, 8ssq_A, 2lt7_A, 2gli_A, 8gh6_A, 7y3m_I, 6e94_A, 1ubd_C, 1tf6_A
Binding Motifs: 4m9v_C TGCGCA
Binding Sites: 4m9v_B
4m9v_A
Publications: Liu Y, Olanrewaju Y.O, Zhang X, Cheng X. DNA recognition of 5-carboxylcytosine by a Zfp57 mutant at an atomic resolution of 0.97 Ã…. Biochemistry 52:9310-7 (2013). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.