Transcription Factor
| Accessions: | 4m9v_C (3D-footprint 20231221) |
| Names: | Zfp-57, ZFP57_MOUSE, Zinc finger protein 57 |
| Organisms: | Mus musculus |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q8C6P8 |
| Length: | 60 |
| Pfam Domains: | 6-28 Zinc finger, C2H2 type 7-28 C2H2-type zinc finger 20-43 Zinc-finger double domain 35-56 Zinc finger, C2H2 type 36-56 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 PSERPFFCNFCGKTYRDASGLSRHRRAHLGYRPRSCPECGKCFRDQSQVNRHLKVHQNKP 60 |
| Interface Residues: | 14, 16, 17, 18, 19, 20, 22, 23, 24, 27, 30, 31, 44, 45, 46, 47, 48, 49, 50, 51, 52, 55, 56, 57 |
| 3D-footprint Homologues: | 8gn3_A, 1yuj_A, 1tf3_A, 1g2f_F, 2kmk_A, 3uk3_C, 8cuc_F, 7y3l_A, 6ml4_A, 5v3j_F, 4x9j_A, 2jpa_A, 7n5w_A, 6blw_A, 5kkq_D, 8ssu_A, 2drp_D, 6u9q_A, 5yel_A, 5ei9_F, 7txc_E, 5kl3_A, 7ysf_A, 1llm_D, 6wmi_A, 5k5i_A, 2lt7_A, 8h9h_G, 7w1m_H, 6jnm_A, 5und_A, 1mey_C, 6a57_A, 5k5l_F, 2wbs_A, 8ssq_A, 1f2i_J, 2gli_A, 4m9v_C, 8gh6_A, 7y3m_I, 6e94_A, 2i13_A, 7eyi_G, 1ubd_C, 1tf6_A, 5yj3_D, 3c0w_A |
| Binding Motifs: | 4m9v_C TGCGCA |
| Binding Sites: | 4m9v_B 4m9v_A |
| Publications: | Liu Y, Olanrewaju Y.O, Zhang X, Cheng X. DNA recognition of 5-carboxylcytosine by a Zfp57 mutant at an atomic resolution of 0.97 Ã…. Biochemistry 52:9310-7 (2013). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.