Transcription Factor

Accessions: T10377 (AthalianaCistrome v4_May2016)
Names: AT2G28920, T10377;
Organisms: Arabidopsis thaliana
Libraries: AthalianaCistrome v4_May2016 1
1 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]
Notes: ecotype:Col-0, experiment type: DAP-seq
Length: 145
Pfam Domains: 89-135 RING-H2 zinc finger
91-137 Ring finger domain
91-140 Zinc finger, C3HC4 type (RING finger)
91-135 Zinc finger, C3HC4 type (RING finger)
93-134 Zinc finger, C3HC4 type (RING finger)
Sequence:
(in bold interface residues)
1 MASSCCGDYVAAASPEMSTVMGSESIVLRLLCVVFIILFYGSIILLCFVMYPKLPKEEIG 60
61 DEEAGEPLPPAVRLTKCGGGDGGDGDGVKADVCVICLEDFKVNDVVRVLVRCKHVFHVDC 120
121 IDSWCFYKLTCPICRAPFQWFGGDW
Interface Residues: 102, 104, 105, 108
3D-footprint Homologues: 6e94_A
Binding Motifs: M0714 awAAATATCT
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.