Transcription Factor

Accessions: EVX2_DBD (HumanTF 1.0), EVX2 (HT-SELEX2 May2017)
Names: EVX-2, EVX2, EVX2_HUMAN, Homeobox even-skipped homolog protein 2, ENSG00000174279
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HT-SELEX2 May2017 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: Q03828
Notes: Ensembl ID: ENSG00000174279; DNA-binding domain sequence; TF family: homeodomain; Clone source: Gene synthesis, TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2
Length: 249
Pfam Domains: 160-216 Homeobox domain
Sequence:
(in bold interface residues)
1 NSAGNAVLEALENSQHPARLSPRLPSAPLHSALGELPAKGKFEIDTLFNLQHTGSESTVS 60
61 SEISSAAESRKKPGHYSEAAAEADMSSDVEVGCSALRSPGGLGAAQLKENNGKGYAESGS 120
121 AAGTTTSASGSGLGSLHGGSGGSGGSAALGGSGSGADQVRRYRTAFTREQIARLEKEFYR 180
181 ENYVSRPRRCELAAALNLPETTIKVWFQNRRMKDKRQRLAMSWPHPADPSFYTYMMTHAA 240
241 ATGSLPYPF
Interface Residues: 142, 143, 144, 147, 151, 155, 160, 161, 162, 163, 201, 202, 204, 205, 208, 209, 211, 212, 213, 216
3D-footprint Homologues: 1e3o_C, 3cmy_A, 8pmf_A, 5zfz_A, 1puf_A, 1ig7_A, 3d1n_M, 8ejp_B, 6a8r_A, 1fjl_B, 1jgg_B, 3lnq_A, 1nk2_P, 1zq3_P, 2lkx_A, 2ld5_A, 7q3o_C, 6es3_K, 4xrs_G, 2hdd_A, 1b72_A, 4cyc_A, 2r5y_A, 6m3d_C, 5flv_I, 2hos_A, 9b8u_A, 5zjt_E, 4j19_B, 1puf_B, 8ik5_C, 7psx_B, 5hod_A, 3a01_E, 8osb_E, 5jlw_D, 3rkq_B, 8eml_B, 1le8_A, 7xrc_C, 2xsd_C, 1au7_A, 8g87_X, 1mnm_C, 8bx1_A, 1du0_A, 4qtr_D, 1k61_B, 1o4x_A
Binding Motifs: EVX2_DBD svTaATTAgc
EVX2_3 sTaATTAs
EVX2_methyl_1 sTAATTAg
EVX2_methyl_2 vTCrTTAd
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.