Transcription Factor
| Accessions: | GLI2 (HT-SELEX2 May2017) |
| Names: | ENSG00000074047, GLI2 |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Notes: | TF family: Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 3, TF family: Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 3 |
| Length: | 195 |
| Pfam Domains: | 20-43 Zinc finger, C2H2 type 20-43 C2H2-type zinc finger 51-78 Zinc finger, C2H2 type 71-96 Zinc-finger double domain 84-108 C2H2-type zinc finger 84-108 Zinc finger, C2H2 type 100-127 Zinc-finger double domain 114-139 C2H2-type zinc finger 114-139 Zinc finger, C2H2 type 133-157 Zinc-finger double domain 145-170 C2H2-type zinc finger 145-170 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 DLDRDDCKQEAEVVIYETNCHWEDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTR 60 61 EQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEG 120 121 CNKAFSNASDRAKHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQ 180 181 RNDVHLRTPLLKENG |
| Interface Residues: | 30, 31, 33, 34, 37, 66, 67, 68, 69, 70, 72, 73, 75, 76, 79, 96, 97, 98, 99, 100, 102, 103, 104, 126, 127, 128, 129, 130, 131, 132, 133, 134, 137, 157, 158, 159, 160, 161, 163, 164, 168, 178, 179, 180, 181, 184, 187 |
| 3D-footprint Homologues: | 5v3j_F, 6wmi_A, 1ubd_C, 6jnm_A, 3uk3_C, 8cuc_F, 7y3l_A, 7n5w_A, 6blw_A, 2gli_A, 1tf6_A, 5ei9_F, 7eyi_G, 8h9h_G, 2i13_A, 6e94_A, 6a57_A, 2jpa_A, 7w1m_H, 8ssu_A, 5kkq_D, 8ssq_A, 1tf3_A, 1mey_C, 5und_A, 1f2i_J, 5k5i_A, 2kmk_A, 6ml4_A, 8gn3_A, 1g2f_F, 6u9q_A, 5yel_A, 4x9j_A, 1llm_D, 7txc_E, 5kl3_A, 7ysf_A, 5yj3_D, 4m9v_C, 2lt7_A, 7y3m_I, 2drp_D, 2wbs_A |
| Binding Motifs: | GLI2_2 vGACCACCCACgwyG GLI2_methyl_1 rGACCACCCACgwwG |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.