Transcription Factor

						

			
Accessions: 1dgc_A (3D-footprint 20231221)

			
Names: Amino acid biosynthesis regulatory protein, GCN4_YEAST, General control protein GCN4
Organisms: Saccharomyces cerevisiae, Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P03069
Length: 55
Pfam Domains:      3-52 bZIP transcription factor
     4-50 Basic region leucine zipper
Sequence: 
(in bold interface residues)		   1 PAALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKLVGER
Interface Residues: 5, 6, 8, 9, 10, 11, 12, 13, 16, 17
3D-footprint Homologues: 7x5e_F, 1nwq_C, 6mg1_B, 1llm_D, 5t01_B, 5vpe_D, 2dgc_A
Binding Motifs: 1dgc_A CGTca
Binding Sites: 1dgc_B
			
Publications: König P, Richmond T.J. The X-ray structure of the GCN4-bZIP bound to ATF/CREB site DNA shows the complex depends on DNA flexibility. Journal of molecular biology 233:139-54 (1993). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.