Transcription Factor
| Accessions: | SOX2_MOUSE (HOCOMOCO 10), P48432 (JASPAR 2024) |
| Names: | SOX2_MOUSE |
| Organisms: | Mus musculus |
| Libraries: | HOCOMOCO 10 1, JASPAR 2024 2 1 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Length: | 319 |
| Pfam Domains: | 40-103 Domain of unknown function (DUF1898) 43-111 HMG (high mobility group) box 112-202 SOX transcription factor |
| Sequence: (in bold interface residues) | 1 MYNMMETELKPPGPQQASGGGGGGGNATAAATGGNQKNSPDRVKRPMNAFMVWSRGQRRK 60 61 MAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKT 120 121 LMKKDKYTLPGGLLAPGGNSMASGVGVGAGLGGGLNQRMDSYAHMNGWSNGSYSMMQEQL 180 181 GYPQHPGLNAHGAAQMQPMHRYVVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALG 240 241 SMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMAQHY 300 301 QSGPVPGTAKYGTLPLSHM |
| Interface Residues: | 45, 48, 50, 51, 52, 54, 58, 69, 70, 71, 74, 112, 116 |
| 3D-footprint Homologues: | 3tmm_A, 4y60_C, 2gzk_A, 1j5n_A, 6jrp_D, 2lef_A, 3u2b_C, 1o4x_B, 7m5w_A, 3f27_D, 4s2q_D, 1qrv_A, 1hry_A, 3tq6_B, 1ckt_A, 7zie_A |
| Binding Motifs: | MA0142.1 ywTTswyATGCAaAt MA0143.1 cywTTGTyaTgcaaA MA0143.3 CCwTTGTy SOX2_MOUSE.H10MO.A|M01346 cYwTTGTyaTgcaaAt MA0143.2 cywTTGTyaTgcaaA |
| Binding Sites: | MA0142.1.1 MA0142.1.10 MA0142.1.11 MA0142.1.12 MA0142.1.13 MA0142.1.14 MA0142.1.15 MA0142.1.16 MA0142.1.17 MA0142.1.18 MA0142.1.19 MA0142.1.2 MA0142.1.20 MA0142.1.3 MA0142.1.4 MA0142.1.5 MA0142.1.6 MA0142.1.7 MA0142.1.8 MA0142.1.9 MA0143.1.1 MA0143.1.10 MA0143.1.11 MA0143.1.12 MA0143.1.13 MA0143.1.14 MA0143.1.15 MA0143.1.16 MA0143.1.17 MA0143.1.18 MA0143.1.19 MA0143.1.2 MA0143.1.20 MA0143.1.3 MA0143.1.4 MA0143.1.5 MA0143.1.6 MA0143.1.7 MA0143.1.8 MA0143.1.9 MA0143.3.1 MA0143.3.10 MA0143.3.11 MA0143.3.12 MA0143.3.13 MA0143.3.14 / MA0143.3.15 MA0143.3.16 MA0143.3.17 MA0143.3.18 MA0143.3.19 MA0143.3.2 MA0143.3.20 MA0143.3.3 MA0143.3.4 MA0143.3.5 MA0143.3.6 MA0143.3.7 MA0143.3.8 MA0143.3.9 |
| Publications: | Chen X, Xu H, Yuan P, Fang F, Huss M, Vega V.B, Wong E, Orlov Y.L, Zhang W, Jiang J, Loh Y.H, Yeo H.C, Yeo Z.X, Narang V, Govindarajan K.R, Leong B, Shahab A, Ruan Y, Bourque G, Sung W.K, Clarke N.D, Wei C.L, Ng H.H. Integration of external signaling pathways with the core transcriptional network in embryonic stem cells. Cell 133:1106-17 (2008). [Pubmed] Maruyama M., Ichisaka T., Nakagawa M., Yamanaka S. Differential roles for Sox15 and Sox2 in transcriptional control in mouse embryonic stem cells.. J. Biol. Chem. 280:24371-24379 (2005). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.