Transcription Factor

Accessions: 3wu1_A (3D-footprint 20231221)
Names: Acute myeloid leukemia 1 protein, CBF-alpha-2, Core-binding factor subunit alpha-2, Oncogene AML-1, PEA2-alpha B, PEBP2-alpha B, Polyomavirus enhancer-binding protein 2 alpha B subunit, Runt-related transcription factor 1, RUNX1_MOUSE, SL3-3 enhancer factor 1 alpha B subunit, SL3/AKV core-binding factor alpha B subunit
Organisms: Mus musculus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q03347
Length: 123
Pfam Domains: 2-123 Runt domain
Sequence:
(in bold interface residues)
1 LADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYS 60
61 AELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPR 120
121 EPR
Interface Residues: 26, 88, 116, 117, 120, 123
3D-footprint Homologues: 4l0y_A, 4l18_E, 6vg8_D, 3wts_A, 6vgd_D
Binding Motifs: 3wu1_A AAGCCACA
3wu1_AB AGGATGTGGCTT
Binding Sites: 3wu1_C
3wu1_D
Publications: Shiina M, Hamada K, Inoue-Bungo T, Shimamura M, Uchiyama A, Baba S, Sato K, Yamamoto M, Ogata K. A Novel Allosteric Mechanism on Protein-DNA Interactions underlying the Phosphorylation-Dependent Regulation of Ets1 Target Gene Expressions. Journal of molecular biology 427:1655-69 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.