Transcription Factor

Accessions: HMX2_DBD (HumanTF 1.0), HMX2 (HT-SELEX2 May2017)
Names: HMX2, HMX2_HUMAN, Homeobox protein H6 family member 2, Homeobox protein HMX2, ENSG00000188816
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HT-SELEX2 May2017 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: A2RU54
Notes: Ensembl ID: ENSG00000188816; DNA-binding domain sequence; TF family: homeodomain; Clone source: Gene synthesis, TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4
Length: 108
Pfam Domains: 26-82 Homeobox domain
Sequence:
(in bold interface residues)
1 PAGSPSPGSERPRDGGAERQAGAAKKKTRTVFSRSQVYQLESTFDMKRYLSSSERACLAS 60
61 SLQLTETQVKTWFQNRRNKWKRQLSAELEAANMAHASAQTLVSMPLVF
Interface Residues: 8, 9, 12, 26, 27, 28, 29, 67, 68, 70, 71, 74, 75, 78, 79, 82
3D-footprint Homologues: 5zfz_A, 3cmy_A, 3d1n_M, 1ig7_A, 2h1k_B, 1puf_A, 6a8r_A, 1fjl_B, 1nk2_P, 1zq3_P, 1jgg_B, 3lnq_A, 2lkx_A, 7q3o_C, 2ld5_A, 6es3_K, 1b72_A, 4xrs_G, 2hdd_A, 3rkq_B, 2r5y_A, 5flv_I, 2hos_A, 5zjt_E, 4cyc_A, 5hod_A, 3l1p_A, 1au7_A, 3a01_E, 7psx_B, 5jlw_D, 1ic8_B, 1le8_A, 7xrc_C, 2xsd_C, 1e3o_C, 2h8r_B, 6fqp_B, 1du0_A, 1o4x_A, 1le8_B, 6fqq_E, 8g87_X, 4qtr_D, 1mnm_C, 1puf_B, 1k61_B
Binding Motifs: HMX2_DBD acCAmTTAAma
HMX2_2 sCAmTYamc
HMX2_4 acCAmTTAAc
HMX2_methyl_1 sCAmTTAac
HMX2_methyl_3 acCAMTTAAc
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.