Transcription Factor
| Accessions: | 1llm_C (3D-footprint 20250804) |
| Names: | Amino acid biosynthesis regulatory protein, chimera of Zif23-GCN4, GCN4_YEAST, General control protein GCN4 |
| Organisms: | Saccharomyces cerevisiae, Saccharomyces cerevisiae (strain ATCC 204508 / S288c) |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Length: | 87 |
| Pfam Domains: | 4-26 C2H2-type zinc finger 4-26 Zinc finger, C2H2 type 18-42 Zinc-finger double domain 32-52 C2H2-type zinc finger 32-55 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 MKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHRDIQHILPIL 60 61 EDKVEELLSKNYHLENEVARLKKLVGE |
| Interface Residues: | 4, 12, 14, 15, 16, 17, 18, 19, 20, 21, 22, 42, 43, 44, 45, 46, 47, 48, 49, 50, 52, 53, 54, 55, 70, 71, 72, 73 |
| 3D-footprint Homologues: | 2kmk_A, 2drp_D, 8cuc_F, 7y3l_A, 1g2f_F, 6ml4_A, 3uk3_C, 6blw_A, 5k5i_A, 6u9q_A, 5yel_A, 8ssu_A, 1f2i_J, 5kkq_D, 2lt7_A, 7n5w_A, 4x9j_A, 2gli_A, 6jnm_A, 5kl3_A, 1ubd_C, 8h9h_G, 7txc_E, 6a57_A, 5ei9_F, 2jpa_A, 1llm_D, 7ysf_A, 5v3j_F, 4m9v_C, 7w1m_H, 1tf3_A, 6e94_A, 1tf6_A, 7y3m_I, 8ssq_A, 8gn3_A, 5yj3_D, 2wbs_A, 2dgc_A |
| Binding Motifs: | 1llm_CD cCCACGCGtGGG |
| Publications: | Wolfe S.A, Grant R.A, Pabo C.O. Structure of a designed dimeric zinc finger protein bound to DNA. Biochemistry 42:13401-9 (2003). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.