Transcription Factor

Accessions: 1llm_C (3D-footprint 20241219)
Names: Amino acid biosynthesis regulatory protein, chimera of Zif23-GCN4, GCN4_YEAST, General control protein GCN4
Organisms: Saccharomyces cerevisiae, Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Length: 87
Pfam Domains: 4-26 Zinc finger, C2H2 type
4-26 C2H2-type zinc finger
18-42 Zinc-finger double domain
32-55 Zinc finger, C2H2 type
32-52 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 MKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHRDIQHILPIL 60
61 EDKVEELLSKNYHLENEVARLKKLVGE
Interface Residues: 4, 12, 14, 15, 16, 17, 18, 21, 42, 43, 44, 45, 46, 49, 53
3D-footprint Homologues: 2kmk_A, 2drp_D, 8cuc_F, 7y3l_A, 7ysf_A, 6u9q_A, 8ssu_A, 2lt7_A, 7n5w_A, 2gli_A, 5v3j_F, 1ubd_C, 8h9h_G, 7txc_E, 2jpa_A, 6e94_A, 8ssq_A, 7w1m_H, 1tf3_A, 1tf6_A, 7y3m_I, 8gn3_A, 2dgc_A
Binding Motifs: 1llm_CD cCCACGCGtGGG
Publications: Wolfe S.A, Grant R.A, Pabo C.O. Structure of a designed dimeric zinc finger protein bound to DNA. Biochemistry 42:13401-9 (2003). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.