Transcription Factor
Accessions: | 2c9n_Y (3D-footprint 20241219), 2c9n_Z (3D-footprint 20241219) |
Names: | BZLF1 TRANS-ACTIVATOR PROTEIN, BZLF1_EBVB9, EB1, Trans-activator protein BZLF1, Zebra |
Organisms: | Epstein-Barr virus (strain B95-8) (HHV-4), Human herpesvirus 4 |
Libraries: | 3D-footprint 20241219 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P03206 |
Length: | 59 |
Pfam Domains: | 1-52 bZIP transcription factor |
Sequence: (in bold interface residues) | 1 KRYKNRVASRKCRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTPD |
Interface Residues: | 1, 2, 5, 6, 8, 9, 12, 13 |
3D-footprint Homologues: | 7x5e_F, 8k8c_A, 2c9l_Z |
Binding Motifs: | 2c9n_Y acTcA 2c9n_YZ TGAGTCA |
Binding Sites: | 2c9n_B 2c9n_A |
Publications: | Petosa C, Morand P, Baudin F, Moulin M, Artero J.B, Müller C.W. Structural basis of lytic cycle activation by the Epstein-Barr virus ZEBRA protein. Molecular cell 21:565-72 (2006). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.