Transcription Factor
Accessions: | 5v0l_A (3D-footprint 20231221) |
Names: | ARNT protein, ARNT_HUMAN, Aryl hydrocarbon receptor nuclear translocator, bHLHe2, Class E basic helix-loop-helix protein 2, Dioxin receptor, nuclear translocator, HIF-1-beta, HIF1-beta, Hypoxia-inducible factor 1-beta |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P27540 |
Length: | 176 |
Pfam Domains: | 11-62 Helix-loop-helix DNA-binding domain 74-139 PAS fold |
Sequence: (in bold interface residues) | 1 QSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMK 60 61 SLKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPQPQSEWFGSTLYDQVHP 120 121 DDVDKLREQLSGSRRSFICRMRCEPHFVVVHCTGYDDDPEAGQGSKFCLVAIGRLQ |
Interface Residues: | 11, 13, 14, 15, 17, 18, 21, 22, 48 |
3D-footprint Homologues: | 1a0a_B, 1an4_A, 5eyo_A, 1am9_A, 7ssa_L, 5nj8_D, 4zpk_A, 8osl_O, 6g1l_A, 5gnj_I, 5sy7_B, 4zpk_B, 7d8t_A, 5i50_B, 4h10_A, 7xi3_A, 5v0l_A, 4zpr_B, 7rcu_E, 4h10_B, 8osl_P, 5nj8_C, 7xhv_B, 5v0l_B, 7xi3_B |
Binding Motifs: | 5v0l_A wsAnC 5v0l_AB wcAGC |
Binding Sites: | 5v0l_C 5v0l_D |
Publications: | Seok SH, Lee W, Jiang L, Molugu K, Zheng A, Li Y, Park S, Bradfield CA, Xing Y. Structural hierarchy controlling dimerization and target DNA recognition in the AHR transcriptional complex. Proc Natl Acad Sci U S A 114:5431-5436 (2017). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.