Transcription Factor

Accessions: 3tq6_A (3D-footprint 20241219), 6hb4_D (3D-footprint 20241219)
Names: Mitochondrial transcription factor 1, MtTF1, mtTFA, TCF-6, TFAM_HUMAN, Transcription factor 6, Transcription factor 6-like 2, Transcription factor A, mitochondrial
Organisms: Homo sapiens
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q00059
Length: 194
Pfam Domains: 7-69 Domain of unknown function (DUF1898)
7-75 HMG (high mobility group) box
111-172 Domain of unknown function (DUF1898)
112-175 HMG (high mobility group) box
Sequence:
(in bold interface residues)
1 SVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAY 60
61 RAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYN 120
121 VYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMI 180
181 EVGRKDLLRRTIKK
Interface Residues: 9, 12, 14, 15, 22, 34, 38, 96, 98, 100, 103, 114, 119, 120, 123, 135, 136, 139
3D-footprint Homologues: 2gzk_A, 7zie_A
Binding Motifs: 3tq6_AB ACAGnnAnnnnCCAACAnnnaACAGTCAnnnnCCAAC
6hb4_ADGJ AATTGAnnnnnnnCACAnnnnnAATTGAnnnnnnnCACAGnnnnnATTGAnnnnnnnCACAGnnnnAATTGAnnnnnnnCACAG
Publications: Rubio-Cosials A, Sidow J.F, Jiménez-Menéndez N, Fernández-Millán P, Montoya J, Jacobs H.T, Coll M, Bernadó P, Solà M. Human mitochondrial transcription factor A induces a U-turn structure in the light strand promoter. Nature structural & molecular biology 18:1281-9 (2011). [Pubmed]

Cuppari A, Fernández-Millán P, Battistini F, Tarrés-Solé A, Lyonnais S, Iruela G, Ruiz-López E, Enciso Y, Rubio-Cosials A, Prohens R, Pons M, Alfonso C, Tóth K, Rivas G, Orozco M, Solà M. DNA specificities modulate the binding of human transcription factor A to mitochondrial DNA control region. Nucleic Acids Res 47:6519-6537 (2019). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.