Transcription Factor
| Accessions: | 3tq6_A (3D-footprint 20231221), 6hb4_D (3D-footprint 20231221) |
| Names: | Mitochondrial transcription factor 1, MtTF1, mtTFA, TCF-6, TFAM_HUMAN, Transcription factor 6, Transcription factor 6-like 2, Transcription factor A, mitochondrial |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q00059 |
| Length: | 194 |
| Pfam Domains: | 7-75 HMG (high mobility group) box 7-69 Domain of unknown function (DUF1898) 111-172 Domain of unknown function (DUF1898) 112-175 HMG (high mobility group) box |
| Sequence: (in bold interface residues) | 1 SVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAY 60 61 RAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYN 120 121 VYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMI 180 181 EVGRKDLLRRTIKK |
| Interface Residues: | 9, 12, 14, 15, 18, 22, 33, 34, 35, 38, 96, 97, 98, 100, 103, 104, 114, 119, 120, 123, 127, 135, 136, 139 |
| 3D-footprint Homologues: | 4y60_C, 1o4x_B, 3tmm_A, 6jrp_D, 1qrv_A, 2gzk_A, 3u2b_C, 1j5n_A, 3f27_D, 3tq6_B, 1hry_A, 1ckt_A, 7zie_A |
| Binding Motifs: | 3tq6_AB ACAGnnAnnnnCCAACAnnnaACAGTCAnnnnCCAAC 6hb4_ADGJ AATTGAnnnnnnnCACAnnnnnAATTGAnnnnnnnCACAGnnnnnATTGAnnnnnnnCACAGnnnnAATTGAnnnnnnnCACAG |
| Publications: | Rubio-Cosials A, Sidow J.F, Jiménez-Menéndez N, Fernández-Millán P, Montoya J, Jacobs H.T, Coll M, Bernadó P, Solà M. Human mitochondrial transcription factor A induces a U-turn structure in the light strand promoter. Nature structural & molecular biology 18:1281-9 (2011). [Pubmed] Cuppari A, Fernández-Millán P, Battistini F, Tarrés-Solé A, Lyonnais S, Iruela G, Ruiz-López E, Enciso Y, Rubio-Cosials A, Prohens R, Pons M, Alfonso C, Tóth K, Rivas G, Orozco M, Solà M. DNA specificities modulate the binding of human transcription factor A to mitochondrial DNA control region. Nucleic Acids Res 47:6519-6537 (2019). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.