Transcription Factor

						

			
Accessions: T01851 (AthalianaCistrome v4_May2016)

			
Names: AT1G23810, T01851;
Organisms: Arabidopsis thaliana
Libraries: AthalianaCistrome v4_May2016 1
1 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]
Notes: ecotype:Col-0, experiment type: DAP-seq, family:Orphan
Length: 241
Pfam Domains:     31-77 Paired amphipathic helix repeat
  125-170 Paired amphipathic helix repeat
  190-234 Paired amphipathic helix repeat
Sequence: MAGGSKSPASSLEDGKAYVNAVKVALEEAEPAKYQEFLRLFHEVIARRMGMATFSARMQD
LLKDHPSLCLGLNVMLAPEYQRAIPPEASEEFHKVVGRSVPRPEPTIDDATSYLIAVKEA
FHDEPAKYEEMLKLLNDFKARRVNAASVIARVEELMKDHSNLLFGFCVFLSATTSFTTKL
KAKFQGDGSQVVDSVLQIMRMYGEGNKSKHDAYQEIVALVQGHDDLVMELSQIFTDPSTR
V
Binding Motifs: M0720 TTCTAGAAgcTTCywtw
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.